Property Summary

NCBI Gene PubMed Count 24
PubMed Score 45.92
PubTator Score 30.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-03
Amyotrophic lateral sclerosis 1.073 1.8e-06
astrocytic glioma -1.400 1.5e-02
atypical teratoid / rhabdoid tumor -1.100 5.7e-04
Breast cancer 2.200 4.0e-02
ependymoma -1.200 4.5e-02
glioblastoma -1.200 1.1e-04
invasive ductal carcinoma 1.300 2.6e-02
malignant mesothelioma 1.100 2.1e-06
osteosarcoma -1.359 7.9e-05
ovarian cancer 1.300 4.2e-03
subependymal giant cell astrocytoma -1.026 3.3e-02

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNV      1 - 70
LLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDAVS     71 - 140
LKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQR    141 - 210
RNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGA    211 - 280
ALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFE    281 - 350
DIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV    351 - 420
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQK    421 - 490
PVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS                                         491 - 523
//

Text Mined References (39)

PMID Year Title