Property Summary

NCBI Gene PubMed Count 23
PubMed Score 44.69
PubTator Score 30.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.100 2.1e-06
astrocytic glioma -1.400 1.5e-02
ependymoma -1.200 4.5e-02
osteosarcoma -1.359 7.9e-05
atypical teratoid / rhabdoid tumor -1.100 5.7e-04
glioblastoma -1.200 1.1e-04
Amyotrophic Lateral Sclerosis 1.073 1.8e-06
Breast cancer 2.200 4.0e-02
adult high grade glioma -1.200 1.2e-03
subependymal giant cell astrocytoma -1.026 3.3e-02
invasive ductal carcinoma 1.300 2.6e-02
ovarian cancer 1.300 4.2e-03

Protein-protein Interaction (8)

Gene RIF (6)

PMID Text
25422374 although dynein lacking light intermediate chains (LICs) drives microtubule gliding at normal rates, the LICs are required for the formation and maintenance of a bipolar spindle.
25231297 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
22190034 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
21169557 using a variety of complementary approaches, our results indicate a novel specific role for the LICs in dynein recruitment to components of the late endocytic pathway.
20026645 Rab11a, FIP3 and DLIC-1 form a ternary complex and DLIC-1 colocalises with endogenous FIP3 and Rab11a in A431 cells.
19229290 Dynein light intermediate chain 1 is required for progress through the spindle assembly checkpoint

AA Sequence

MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNV      1 - 70
LLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDAVS     71 - 140
LKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQR    141 - 210
RNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGA    211 - 280
ALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFE    281 - 350
DIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV    351 - 420
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQK    421 - 490
PVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS                                         491 - 523
//

Text Mined References (38)

PMID Year Title
27482052 2016 Assembly and activation of dynein-dynactin by the cargo adaptor protein Hook3.
25422374 2014 Dynein light intermediate chains maintain spindle bipolarity by functioning in centriole cohesion.
25416956 2014 A proteome-scale map of the human interactome network.
25272277 2014 A Ras-like domain in the light intermediate chain bridges the dynein motor to a cargo-binding region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
21169557 2011 Recruitment of dynein to late endosomes and lysosomes through light intermediate chains.
20964624 2011 Dynein LIC1 localizes to the mitotic spindle and midbody and LIC2 localizes to spindle poles during cell division.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20026645 2010 Rab11-FIP3 links the Rab11 GTPase and cytoplasmic dynein to mediate transport to the endosomal-recycling compartment.
20006841 2009 Adenovirus transport via direct interaction of cytoplasmic dynein with the viral capsid hexon subunit.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19229290 2009 Dynein light intermediate chain 1 is required for progress through the spindle assembly checkpoint.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260502 2005 Cytoplasmic dynein nomenclature.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11243854 2001 The small GTPase Rab4A interacts with the central region of cytoplasmic dynein light intermediate chain-1.
10893222 2000 Light intermediate chain 1 defines a functional subfraction of cytoplasmic dynein which binds to pericentrin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.