Property Summary

NCBI Gene PubMed Count 76
PubMed Score 54.25
PubTator Score 69.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.100 3.0e-06
ependymoma -1.500 2.8e-02
osteosarcoma 3.428 1.5e-09
astrocytoma 1.100 1.7e-02
juvenile dermatomyositis 1.079 2.4e-05
lung cancer 1.100 6.0e-04
diabetes mellitus -1.100 1.8e-03
Pick disease 1.700 2.4e-04
ovarian cancer 1.900 4.6e-05

 GWAS Trait (1)

Gene RIF (38)

PMID Text
26100331 Our findings suggest that DYNC1H1 variants can cause not only lower, but also upper motor neuron disease.
25818806 HIV-1 uncoating is facilitated by dynein motor function since siRNA knockdown of DYNC1H1 increases the amount of HIV-1 p24 associated with cytoplasmic virions
25609763 Report expands the clinical spectrum of DYNC1H1-related spinal muscular atrophy to include generalized arthrogryposis
25512093 The mutations in DYNC1H1 increase the interaction with its adaptor BICD2.
25502651 Dynein heavy chain knockdown by siRNA enhances HIV-1 infectivity in TRIMCyp-expressing HeLa cells but not in TRIMCyp-expressing owl monkey cells
25479096 These findings also reveal a possible new target for Amblyomin-X, i.e., dynein, and may serve as a tool for investigating tumor cell death associated with proteasome inhibition.
25375884 HIV-1 uncoating is facilitated by dynein motor function since siRNA knockdown of DYNC1H1 increases the amount of HIV-1 p24 associated with cytoplasmic virions
25355895 These results reveal that conformational changes involving hexon hypervariable region 1 are the basis for a novel viral mechanism controlling capsid transport to the nucleus by dynein.
25266423 single dynein molecules in the cell are autoinhibited through intramolecular head-head stacking
25231297 Authors find that pharmacological or small interfering RNA (siRNA)-mediated inhibition of cytoplasmic dynein or the kinesin 1 heavy chain KIF5B delays HIV-1 uncoating.
25231297 HIV-1 uncoating is facilitated by dynein motor function since siRNA knockdown of DYNC1H1 increases the amount of HIV-1 p24 associated with cytoplasmic virions
25231297 Dynein heavy chain knockdown by siRNA enhances HIV-1 infectivity in TRIMCyp-expressing HeLa cells but not in TRIMCyp-expressing owl monkey cells
25185702 Dynactin functions as both a dynamic tether and brake during dynein-driven motility.
24755273 This study demonistrated that DYNC1H1 mutation alters transport kinetics and ERK1/2-cFos signalling in a mouse model of distal spinal muscular atrophy.
24751478 Authors propose that Snapin connects chlamydial inclusions with the microtubule network by interacting with both Chlamydia psittaci IncB and dynein.
24600008 In conclusion, association with microtubules and the translocation activity of dynein motor complexes are required to achieve efficient retrovirus restriction by TRIM5alpha.
24307404 Our results expand the set of pathological mutations in DYNC1H1, reinforce the role of cytoplasmic dynein in disorders of neuronal migration, and provide evidence for a syndrome including spinal nerve degeneration and brain developmental problems.
24256283 It focus on cytoplasmic dynein, which is required for a myriad of cellular functions in interphase, mitosis and meiosis, ranging from transport of organelles and functioning of the mitotic spindle to chromosome movements in meiotic prophase.
23742762 This study demonistrated that Dynein mutations associated with hereditary motor neuropathies impair mitochondrial morphology and function with age.
23589491 Dynein forms distinct complexes requiring specific recruiters and activators to promote orderly progression through mitosis.
23583712 The cytoplasmic Dynein Heavy Chain 1 (DHC) was found to interact with NF1 along microtubules in vesicular structures identified to be melanosomes.
23389635 Data indicate that dynein- and astral microtubule-mediated transport of Galphai/LGN/nuclear mitotic apparatus (NuMA) complex from cell cortex to spindle poles.
23213255 analysis of reconstitution of the human cytoplasmic dynein complex
22956769 LIS1 is required for dynein-mediated transport induced by membrane tethering of BICD2-N and LIS1 contributes to dynein accumulation at microtubule plus ends and BICD2-positive cellular structures.
22847149 this study has demonstrated that the same DYNC1H1 mutation could cause spinal muscular atrophy as well as distal neuropathy, indicating pleotropic effects of the mutation.
22459677 study demonstrates that mutations in the tail domain of the heavy chain of cytoplasmic dynein (DYNC1H1) cause spinal muscular atrophy and provide experimental evidence that a DYNC1H1 mutation disrupts dynein complex assembly and function
22373868 Studies indicate that binding of dynactin, LIS1 and NudEL regulate cytoplasmic dynein motor activity.
22368300 Mutations in DYNC1H1 can lead to a broad phenotypic spectrum, confirming the importance of DYNC1H1 in both central and peripheral neuronal functions.
22190034 HIV-1 uncoating is facilitated by dynein motor function since siRNA knockdown of DYNC1H1 increases the amount of HIV-1 p24 associated with cytoplasmic virions
22174317 HIV-1 uncoating is facilitated by dynein motor function since siRNA knockdown of DYNC1H1 increases the amount of HIV-1 p24 associated with cytoplasmic virions
21820100 Exome sequencing of three affected individuals separated by eight meioses identified a single shared novel heterozygous variant, c.917A>G, in DYNC1H1, which encodes the cytoplasmic dynein heavy chain 1.
21723285 In an in vitro MT gliding assay, both dynein-1 and dynein-2 showed minus-end-directed motor activities.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19286658 HIV-1 uncoating is facilitated by dynein motor function since siRNA knockdown of DYNC1H1 increases the amount of HIV-1 p24 associated with cytoplasmic virions
19020519 these results suggest that complexes of dynein, Lis1 and CLIP-170 crosslink and slide microtubules within the spindle, thereby producing an inward force that pulls centrosomes together.
18976975 Dynein heavy chain knockdown by siRNA enhances HIV-1 infectivity in TRIMCyp-expressing HeLa cells but not in TRIMCyp-expressing owl monkey cells
16546759 Observational study of gene-disease association. (HuGE Navigator)
14632200 mediates the perinuclear aggregation of phagocytosed melanosomes, participates in the formation of the supranuclear melanin cap or "microparasol" and serves as a mechanism to help protect the nucleus from ultraviolet-induced DNA damage.

AA Sequence

MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKSALEQMRKFLS      1 - 70
DPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRTPVIDADKPVSSQLRVLTL     71 - 140
SEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIH    141 - 210
PMITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLN    211 - 280
LERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATEL    281 - 350
DKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVF    351 - 420
QTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTA    421 - 490
VAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRV    491 - 560
ETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQS    561 - 630
QACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFD    631 - 700
DWARKVQQRNLGVSGRIFTIESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQ    701 - 770
ANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETV    771 - 840
FNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERI    841 - 910
LGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRY    911 - 980
KLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYRNALTRMPDGPVALEESYSAVMGIVSEVEQY    981 - 1050
VKVWLQYQCLWDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKY   1051 - 1120
DSWHKEVLSKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELY   1121 - 1190
RNGQRLLEKQRFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTD   1191 - 1260
WEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQVALEELQDLK   1261 - 1330
GVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDALLNQLKSFPARLRQYASYEFVQRLLKGYMKINMLV   1331 - 1400
IELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKNEAIVKDVLLVAQGEMALEEFLKQIREVW   1401 - 1470
NTYELDLVNYQNKCRLIRGWDDLFNKVKEHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDV   1471 - 1540
QRRWVYLEGIFTGSADIKHLLPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGK   1541 - 1610
IQKALGEYLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDNSVVLGISSRE   1611 - 1680
GEEVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYITWIDKYQAQLV   1681 - 1750
VLSAQIAWSENVETALSSMGGGGDAAPLHSVLSNVEVTLNVLADSVLMEQPPLRRRKLEHLITELVHQRD   1751 - 1820
VTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYL   1821 - 1890
TMTQALEARLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEF   1891 - 1960
NRLEERMLSAVSQQVQCIQEALREHSNPNYDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPD   1961 - 2030
NLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSA   2031 - 2100
GNVKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPGVQY   2101 - 2170
HRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINHGLMMVGPSGSGKSMAWRVLLKA   2171 - 2240
LERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDGLFTHVLRKIIDSVRGELQKRQWIVFDGDVDPE   2241 - 2310
WVENLNSVLDDNKLLTLPNGERLSLPPNVRIMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLA   2311 - 2380
RLRSIPLDEGEDEAQRRRKGKEDEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFQLEHIMDLT   2381 - 2450
RLRCLGSLFSMLHQACRNVAQYNANHPDFPMQIEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYIRR   2451 - 2520
ITTVPLPTAPNIPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVRHEALLYTWLAEHKP   2521 - 2590
LVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRRTPNGVVLAPVQLGKWLV   2591 - 2660
LFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTWVKLERIQFVGACNPPTDPGRKPLSHRFLRH   2661 - 2730
VPVVYVDYPGPASLTQIYGTFNRAMLRLIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMT   2731 - 2800
RWVRGIFEALRPLETLPVEGLIRIWAHEALRLFQDRLVEDEERRWTDENIDTVALKHFPNIDREKAMSRP   2801 - 2870
ILYSNWLSKDYIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSG   2871 - 2940
AGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESNVLDSGFLERMNT   2941 - 3010
LLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIRNLHVVFTMNPSSEGLKDRAA   3011 - 3080
TSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNYIVPDYMPVVYDKLPQPPSHREAIVNSCVFV   3081 - 3150
HQTLHQANARLAKRGGRTMAITPRHYLDFINHYANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRR   3151 - 3220
DLRIKSQELEVKNAAANDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVI   3221 - 3290
EAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEIS   3291 - 3360
DAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKA   3361 - 3430
NEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSLSAERERWEKTSETFKNQM   3431 - 3500
STIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQFRTDIARTEYLSNADERLRWQASSLPAD   3501 - 3570
DLCTENAIMLKRFNRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVES   3571 - 3640
YDPVLNPVLNREVRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQS   3641 - 3710
QCLNEVLKAERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEV   3711 - 3780
TRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLYQYSLQFFLDIYHNVLYENPNLKGVT   3781 - 3850
DHTQRLSIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTVGEPTYDAEFQHFLRGNEIVLSAGS   3851 - 3920
TPRIQGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFGIWLDSSSPEQTVPYLWSEETPATPIGQAIHRL   3921 - 3990
LLIQAFRPDRLLAMAHMFVSTNLGESFMSIMEQPLDLTHIVGTEVKPNTPVLMCSVPGYDASGHVEDLAA   3991 - 4060
EQNTQITSIAIGSAEGFNQADKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEI   4061 - 4130
NPKVPVNLLRAGRIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLAWFHAIIQERLRYAPLG   4131 - 4200
WSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVDNEFDQRLLNTFLE   4201 - 4270
RLFTTRSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDTQTPSWLGLPNNAERVLLTTQGVDMI   4271 - 4340
SKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLF   4341 - 4410
RFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVS   4411 - 4480
DFSERIKQLQNISLAAASGGAKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTSQG   4481 - 4550
ATLDACSFGVTGLKLQGATCNNNKLSLSNAISTALPLTQLRWVKQTNTEKKASVVTLPVYLNFTRADLIF   4551 - 4620
TVDFEIATKEDPRSFYERGVAVLCTE                                               4621 - 4646
//

Text Mined References (86)

PMID Year Title
26100331 2015 Mutation screen reveals novel variants and expands the phenotypes associated with DYNC1H1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609763 2015 Novel mutations expand the clinical spectrum of DYNC1H1-associated spinal muscular atrophy.
25512093 2015 Novel mutations in the DYNC1H1 tail domain refine the genetic and clinical spectrum of dyneinopathies.
25479096 2014 Dynein function and protein clearance changes in tumor cells induced by a Kunitz-type molecule, Amblyomin-X.
25355895 2015 Conformational changes in the adenovirus hexon subunit responsible for regulating cytoplasmic dynein recruitment.
25272277 2014 A Ras-like domain in the light intermediate chain bridges the dynein motor to a cargo-binding region.
25266423 2014 Autoinhibition and cooperative activation mechanisms of cytoplasmic dynein.
25231297 2014 HIV-1 uncoating is facilitated by dynein and kinesin 1.
25185702 2014 Dynactin functions as both a dynamic tether and brake during dynein-driven motility.
24755273 2014 DYNC1H1 mutation alters transport kinetics and ERK1/2-cFos signalling in a mouse model of distal spinal muscular atrophy.
24751478 2014 Chlamydia psittaci inclusion membrane protein IncB associates with host protein Snapin.
24600008 2014 Functional evidence for the involvement of microtubules and dynein motor complexes in TRIM5?-mediated restriction of retroviruses.
24307404 2014 Novel dynein DYNC1H1 neck and motor domain mutations link distal spinal muscular atrophy and abnormal cortical development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256283 2013 Dynein, microtubule and cargo: a ménage à trois.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23742762 2013 Dynein mutations associated with hereditary motor neuropathies impair mitochondrial morphology and function with age.
23603762 2013 Mutations in TUBG1, DYNC1H1, KIF5C and KIF2A cause malformations of cortical development and microcephaly.
23589491 2013 Systematic dissection of dynein regulators in mitosis.
23583712 2013 Neurofibromin interacts with the cytoplasmic Dynein Heavy Chain 1 in melanosomes of human melanocytes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23389635 2013 Evidence for dynein and astral microtubule-mediated cortical release and transport of G?i/LGN/NuMA complex in mitotic cells.
23213255 2012 Reconstitution of the human cytoplasmic dynein complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
23027904 2012 Cortical dynein is critical for proper spindle positioning in human cells.
22956769 2012 BICD2, dynactin, and LIS1 cooperate in regulating dynein recruitment to cellular structures.
22847149 2012 A DYNC1H1 mutation causes a dominant spinal muscular atrophy with lower extremity predominance.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22459677 2012 Mutations in the tail domain of DYNC1H1 cause dominant spinal muscular atrophy.
22373868 2012 Multiple modes of cytoplasmic dynein regulation.
22368300 2012 Mutations in DYNC1H1 cause severe intellectual disability with neuronal migration defects.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21820100 2011 Exome sequencing identifies a DYNC1H1 mutation in a large pedigree with dominant axonal Charcot-Marie-Tooth disease.
21723285 2011 Recombinant human cytoplasmic dynein heavy chain 1 and 2: observation of dynein-2 motor activity in vitro.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21269460 2011 Initial characterization of the human central proteome.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
21076407 2010 A de novo paradigm for mental retardation.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19020519 2008 Dynein, Lis1 and CLIP-170 counteract Eg5-dependent centrosome separation during bipolar spindle assembly.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17676955 2007 Dynein modifiers in C. elegans: light chains suppress conditional heavy chain mutants.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16546759 2006 No association of DYNC1H1 with sporadic ALS in a case-control study of a northern European derived population: a tagging SNP approach.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16260502 2005 Cytoplasmic dynein nomenclature.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14632200 2003 Role of cytoplasmic dynein in perinuclear aggregation of phagocytosed melanosomes and supranuclear melanin cap formation in human keratinocytes.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11163259 2000 A LIS1/NUDEL/cytoplasmic dynein heavy chain complex in the developing and adult nervous system.
11112706 2001 Immunolocalization of cytoplasmic dynein and dynactin subunits in cultured macrophages: enrichment on early endocytic organelles.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10771482 2000 Role of cytoplasmic dynein in melanosome transport in human melanocytes.
9373155 1997 Identification of dynein heavy chain genes expressed in human and mouse testis: chromosomal localization of an axonemal dynein gene.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8812413 1996 Multiple mouse chromosomal loci for dynein-based motility.
8666668 1996 Mammalian cells express three distinct dynein heavy chains that are localized to different cytoplasmic organelles.
8227145 1993 Cytoplasmic dynein plays a role in mammalian mitotic spindle formation.
8001984 1994 Localization of the human cytoplasmic dynein heavy chain (DNECL) to 14qter by fluorescence in situ hybridization.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.