Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.59
PubTator Score 1.89

Knowledge Summary


No data available


  Disease (1)


Accession Q8WWB3 A8K927 Q5QP03 Q5QP04 Q6WNP4 Q6ZU87
Symbols DPY30D1


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

KTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL                                     141 - 177

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19545932 2009 Interaction of SH3P13 and DYDC1 protein: a germ cell component that regulates acrosome biogenesis during spermiogenesis.
18197198 2008 Myofibrillar myopathy with arrhythmogenic right ventricular cardiomyopathy 7: corroboration and narrowing of the critical region on 10q22.3.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.