Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.09
PubTator Score 1.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q8WWB3 A8K927 Q5QP03 Q5QP04 Q6WNP4 Q6ZU87
Symbols DPY30D1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEM      1 - 70
MERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSG     71 - 140
KTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL                                     141 - 177
//

Text Mined References (11)

PMID Year Title