Property Summary

NCBI Gene PubMed Count 48
PubMed Score 28.36
PubTator Score 28.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.300 5.3e-06
astrocytoma 2.200 2.4e-03
glioblastoma 1.100 4.6e-05
non-small cell lung cancer 1.223 1.5e-15
lung cancer 1.100 2.7e-03
ovarian cancer 1.800 1.0e-04

 GWAS Trait (1)

Gene RIF (19)

PMID Text
27008544 we demonstrate that normally ALFY attenuates the canonical Wnt signaling pathway via autophagy-dependent removal specifically of aggregates of DVL3 and not of Dvl1 or Dvl2.
26924530 All variants in DVL3 result in a -1 frameshift, indicating that these highly specific alterations might be a common cause of dominant Robinow syndrome.
26008736 DVL3 transcripts decreased in individuals with major depressive disorder
25847080 data suggest that miR-204-5p regulates adipogenesis by controlling DVL3 expression and subsequently inhibiting the activation of the Wnt/beta-catenin signaling pathway.
25168481 Tumors that responded to IGFIR inhibition contain relatively lower levels of DVL3 protein than resistant tumors.
25156800 findings confirm that p38 and PAX2 are important for the Dvl-3 induced upregulation of p120ctn
24993822 data (i) support previous the assumption that CK1 acts via phosphorylation of distinct residues as the activator as well as the shut-off signal of Wnt/beta-catenin signaling and (ii) suggest that CK1 acts on Dvl via different mechanism than Fzd5.
24427302 High expression of IGFBP7 in fibroblasts induced by colorectal cancer cells is co-regulated by TGF-beta and Wnt signaling in a Smad2/3-Dvl2/3-dependent manner.
24040443 Study showed an association of DVL-1 and DVL-3 with Hirschsprung's disease.
23301094 AMPK activators suppress cervical cancer cell growth by impairing DVL3 protein synthesis via AMPK/mTOR signaling and/or partially promoting the proteasomal degradation of DVL3
23022960 Dvl3 protein transduce signals via the Wnt proteins non canonical pathways, namely via NFAT protein and Src kinase and novel NPM-ALK interacting proteins and possibly NPM-ALK substrates.
22892949 A harmful p.Ser175Gly substitution & 3 benign variants (p.Ile353Val, p.Ile384Val, & p.Ala641Thr) were found in a cohort of patients with neural tube defects but not in controls.
22612246 Identification of novel post translational modifications of DVL3 by liquid chromatography coupled LTQ-Orbitrap analysis.
22569537 Letter: report expression of dishevelled-3 and EAAT1 and glutamine metabolism in malignant pleural mesothelioma.
21667018 In HEK293T cells with intact Wnt signaling, Rac1b is tethered to these same gene promoters independent of Wnt3A stimulation and is further observed to recruit Dishevelled and beta-catenin in the absence of Wnt3A stimulation.
20137080 The canonical Wnt-signaling proteins LRP6 and Dvl2 and Dvl3 are involved in the regulation of beta-catenin.
18692936 Expression of Dvl-1, Dvl-2 and Dvl-3, is common in non-small cell lung cancer
18093802 The expression of Dishevelleds in mammalian cells provide an estimate of the relative cellular abundance of each Dvl.
17030191 The facilitation of Prickle-1 on Dvl3 degradation and the suppression of beta-catenin activity and cell growth suggest that Prickle-1 is a negative regulator of the Wnt/beta-catenin signaling pathway

AA Sequence

MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCF      1 - 70
NGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVS     71 - 140
AQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSA    141 - 210
SRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGS    211 - 280
IMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRS    281 - 350
EPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA    351 - 420
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQC    421 - 490
YYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSY    491 - 560
GGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAAS    561 - 630
EHSHRSHHSLASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQS    631 - 700
FRMAMGNPSEFFVDVM                                                          701 - 716
//

Text Mined References (57)

PMID Year Title
27008544 2016 ALFY-Controlled DVL3 Autophagy Regulates Wnt Signaling, Determining Human Brain Size.
26924530 2016 DVL3 Alleles Resulting in a -1 Frameshift of the Last Exon Mediate Autosomal-Dominant Robinow Syndrome.
26359454 2015 Cytosolic TMEM88 promotes invasion and metastasis in lung cancer cells by binding DVLS.
26008736 2016 Gene expression in major depressive disorder.
25847080 2015 miR-204-5p promotes the adipogenic differentiation of human adipose-derived mesenchymal stem cells by modulating DVL3 expression and suppressing Wnt/?-catenin signaling.
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25557784 2015 DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling.
25416956 2014 A proteome-scale map of the human interactome network.
25168481 2014 Dsh homolog DVL3 mediates resistance to IGFIR inhibition by regulating IGF-RAS signaling.
25156800 2015 Dishevelled-3 activates p65 to upregulate p120-catenin transcription via a p38-dependent pathway in non-small cell lung cancer.
24993822 2014 Functional analysis of dishevelled-3 phosphorylation identifies distinct mechanisms driven by casein kinase 1? and frizzled5.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24427302 2014 High expression of IGFBP7 in fibroblasts induced by colorectal cancer cells is co-regulated by TGF-? and Wnt signaling in a Smad2/3-Dvl2/3-dependent manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24040443 2013 Expression of dishevelled gene in Hirschsprung's disease.
23301094 2013 AMPK activators suppress cervical cancer cell growth through inhibition of DVL3 mediated Wnt/?-catenin signaling activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23150776 2012 Dishevelled3 is a novel arginine methyl transferase substrate.
23109420 2013 Tiam1 regulates the Wnt/Dvl/Rac1 signaling pathway and the differentiation of midbrain dopaminergic neurons.
23022960 2013 Disheveled proteins promote cell growth and tumorigenicity in ALK-positive anaplastic large cell lymphoma.
22892949 2013 Genetic analysis of disheveled 2 and disheveled 3 in human neural tube defects.
22863007 2012 Exome capture reveals ZNF423 and CEP164 mutations, linking renal ciliopathies to DNA damage response signaling.
22612246 2012 Delicate analysis of post-translational modifications on Dishevelled 3.
22569537 2012 The expression of Dishevelled-3 and glutamine metabolism in malignant pleural mesothelioma.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
21880741 2011 Nuclear factor of activated T cells (NFAT) proteins repress canonical Wnt signaling via its interaction with Dishevelled (Dvl) protein and participate in regulating neural progenitor cell proliferation and differentiation.
21667018 2011 Rac1b recruits Dishevelled and ?-catenin to Wnt target gene promoters independent of Wnt3A stimulation.
21422228 2011 Casein kinase 1 delta functions at the centrosome to mediate Wnt-3a-dependent neurite outgrowth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20412773 2010 The Hippo pathway regulates Wnt/beta-catenin signaling.
20227366 2010 Loss of the tumor suppressor CYLD enhances Wnt/beta-catenin signaling through K63-linked ubiquitination of Dvl.
20137080 2010 Helicobacter pylori-induced activation of beta-catenin involves low density lipoprotein receptor-related protein 6 and Dishevelled.
19625296 2009 Mutations in the LRRK2 Roc-COR tandem domain link Parkinson's disease to Wnt signalling pathways.
19465938 2009 Inhibition of the Wnt/beta-catenin pathway by the WWOX tumor suppressor protein.
19388021 2009 Sequence requirement and subtype specificity in the high-affinity interaction between human frizzled and dishevelled proteins.
19137009 2009 Activation of the non-canonical Dvl-Rac1-JNK pathway by Frizzled homologue 10 in human synovial sarcoma.
18692936 2008 Dishevelled family proteins are expressed in non-small cell lung cancer and function differentially on tumor progression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18093802 2008 Differential mediation of the Wnt canonical pathway by mammalian Dishevelleds-1, -2, and -3.
17593335 2007 Activation of p53 by Dishevelled independent of Wnt or planar polarity pathways.
17030191 2006 Prickle-1 negatively regulates Wnt/beta-catenin pathway by promoting Dishevelled ubiquitination/degradation in liver cancer.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15677333 2005 Identification of the Wnt signaling activator leucine-rich repeat in Flightless interaction protein 2 by a genome-wide functional analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805222 2003 Regulation of the Wnt signaling pathway by disabled-2 (Dab2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11113207 2001 Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein.
10806215 2000 Endogenous protein kinase CK2 participates in Wnt signaling in mammary epithelial cells.
10644691 2000 Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription.
10330181 1999 DIX domains of Dvl and axin are necessary for protein interactions and their ability to regulate beta-catenin stability.
9344861 1997 cDNA cloning of a human dishevelled DVL-3 gene, mapping to 3q27, and expression in human breast and colon carcinomas.
9192851 1997 Human dishevelled genes constitute a DHR-containing multigene family.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
8817329 1996 cDNA characterization and chromosomal mapping of two human homologues of the Drosophila dishevelled polarity gene.