Property Summary

NCBI Gene PubMed Count 81
PubMed Score 219.75
PubTator Score 53.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.418 2.6e-03
adult high grade glioma -1.100 3.3e-04
spina bifida -1.238 4.2e-02

Gene RIF (40)

PMID Text
26924530 Specific -1 frameshift variants in the penultimate exon of DVL1 cause autosomal-dominant Robinow syndrome.
26325443 TMEM88 stimulated triple negative breast cancer cell invasion by interacting with DVLl.
25891077 Data indicate Dishevelled (DVL) as a dual function adaptor to recruit negative regulators ZNRF3/RNF43 to Wnt receptors to ensure proper control of pathway activity.
25817016 DVL1 frameshift mutations clustering in the penultimate exon cause autosomal-dominant Robinow syndrome.
25817014 Mutations in DVL1 cause an osteosclerotic form of Robinow syndrome, with the osteosclerosis possibly the result of an interaction between the wild-type and mutant alleles, leading to elevated canonical Wnt signaling.
25643607 silencing DVL1 sensitized A2780/Taxol cells to paclitaxel, by down-regulating AKT/GSK-3beta/beta-catenin signalling, providing a novel strategy for chemosensitization of ovarian cancer to paclitaxel-induced cytotoxicity.
25436461 Results show that coexpression of IQGAP1 and Dvl in the cytoplasm and nucleus was correlated with the lymph nodal metastase and poor prognosis of non-small cell lung cancer.
25043531 Dvl overexpression may contribute to the malignant proliferation and invasion of human glioma.
24500924 DVL is a master regulator of FZD6/G-protein signaling
24362520 Authors propose a model for Rac1 activation where SIRT1/2 positively modulates the DVL/TIAM1/Rac1 axis and promotes sustained pathway activation.
24129181 DVL1 was localized in the cytoplasm of CRC cells.
24040443 Study showed an association of DVL-1 and DVL-3 with Hirschsprung's disease.
23836490 findings did not provide evidence for the implication of DVL1 in the pathogenesis of human NTDs.
22467858 Data reveal a novel Rac1-dependent signalling pathway that, through Nedd4-mediated ubiquitylation of Dvl1, stimulates the maturation of epithelial cell-cell contacts.
21262972 14-3-3beta interacts with human Dapper1, attenuating the ability of hDpr1 to promote Dishevelled (Dvl) degradation, thus enhancing Wnt signaling
21044957 TMEM88 associates with Dvl proteins and regulates Wnt signaling in a context-dependent manner
20846493 Study demonstrate that the DIX domains of Dvl and Axin are expressed noticeably in a multi-cistronic system but not in a mono-cistronic system.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20412773 the Hippo pathway restricts Wnt/beta-Catenin signaling by promoting an interaction between TAZ and DVL in the cytoplasm
20388731 Dishevelled signals through LRP5/6 in human cells and Drosophila embryos.
20177058 NKD2 antagonizes Wnt signaling: myristoylated NKD2 interacts with Dvl-1 at the plasma membrane, and this interaction leads to their mutual ubiquitin-mediated proteasomal degradation.
19956716 Mutations in the human naked cuticle homolog NKD1 found in colorectal cancer alter Wnt/Dvl/beta-catenin signaling
19561074 Dvl directly interacted with and activated PI4KII alpha by increasing its V(max) for ATP and PtdIns. In addition, Dvl regulated PI4KII alpha and PIP5KI via different domains.
19453261 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of dishevelled, dsh homolog 1 (DVL1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18760999 These results suggest that membrane accumulation of Par1b induced by Dvl is regulated by its phosphorylation status, which is important for Par1b to regulate the microtubule dynamics.
18692936 Expression of Dvl-1, Dvl-2 and Dvl-3, is common in non-small cell lung cancer
18632848 the C6 motif seems to reduce the interaction of Axin with Dvl-1.
18347071 Our results reveal a mechanism by which nuclear Dvl cooperates with c-Jun to regulate gene transcription stimulated by the canonical Wnt signaling pathway.
18162551 a carboxyl-terminal binding partner, Dvl, has a role in activation of Daam1
18093802 The expression of Dishevelleds in mammalian cells provide an estimate of the relative cellular abundance of each Dvl.
16621789 BMP-2 antagonizes Wnt-3a signaling in osteoblast progenitors by promoting an interaction between Smad1 and Dvl-1 that restricts beta-catenin activation
16457155 DVL1 was overexpressed in prostate cancer and its overexpression might be related to prostate cancer progression through the Wnt/beta-catenin pathway.
15262978 Ccd1 drastically inhibited JNK activation both by Axin and by Dvl.
14684739 interaction among misfolded SOD1, NEDL1, translocon-associated protein-delta, and Dishevelled-1 forms a ubiquitinated protein complex that is included in potentially cytotoxic protein aggregates
12883684 amplification and increased expression of the DVL-1 gene may play some role in the development of a portion of human cervical squamous cell cancer through derangement of the Wnt signaling pathway
12824876 Amplification and increased expression of the DVL-1 gene is associated with breast carcinogenesis
12556519 CKI epsilon-dependent phosphorylation of Dvl enhances the formation of a complex of Dvl-1 with Frat-1 and this complex leads to the activation of Wnt-3a-induced accumulation of beta-catenin
11803455 Observational study of gene-disease association. (HuGE Navigator)
11803455 The DVL1 gene spans a region of approximately 13.8 kb with 15 exons and six rare sequence variations. None of these had any association with late onset AD.

AA Sequence

MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKL      1 - 70
PCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESM     71 - 140
VSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQS    141 - 210
TSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYI    211 - 280
GSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVP    281 - 350
RADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVR    351 - 420
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFS    421 - 490
EQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSY    491 - 560
GSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSP    561 - 630
RSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM         631 - 695
//

Text Mined References (82)

PMID Year Title
26924530 2016 DVL3 Alleles Resulting in a -1 Frameshift of the Last Exon Mediate Autosomal-Dominant Robinow Syndrome.
26325443 2015 Cytosolic TMEM88 promotes triple-negative breast cancer by interacting with Dvl.
25891077 2015 Dishevelled promotes Wnt receptor degradation through recruitment of ZNRF3/RNF43 E3 ubiquitin ligases.
25817016 2015 DVL1 frameshift mutations clustering in the penultimate exon cause autosomal-dominant Robinow syndrome.
25817014 2015 Mutations in DVL1 cause an osteosclerotic form of Robinow syndrome.
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25643607 2015 Silencing dishevelled-1 sensitizes paclitaxel-resistant human ovarian cancer cells via AKT/GSK-3?/?-catenin signalling.
25557784 2015 DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling.
25436461 2014 Coexpression of IQ-domain GTPase-activating protein 1 (IQGAP1) and Dishevelled (Dvl) is correlated with poor prognosis in non-small cell lung cancer.
25043531 2014 The expression and significance of dishevelled in human glioma.
24500924 2014 Disheveled regulates precoupling of heterotrimeric G proteins to Frizzled 6.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24362520 2015 The sirtuins promote Dishevelled-1 scaffolding of TIAM1, Rac activation and cell migration.
24129181 2013 Significant overexpression of DVL1 in Taiwanese colorectal cancer patients with liver metastasis.
24040443 2013 Expression of dishevelled gene in Hirschsprung's disease.
23836490 2013 Rare missense variants in DVL1, one of the human counterparts of the Drosophila dishevelled gene, do not confer increased risk for neural tube defects.
22773187 2012 Dual functions of DP1 promote biphasic Wnt-on and Wnt-off states during anteroposterior neural patterning.
22467858 2012 Rac1 acts in conjunction with Nedd4 and dishevelled-1 to promote maturation of cell-cell contacts.
21262972 2011 Protein kinase A-mediated 14-3-3 association impedes human Dapper1 to promote dishevelled degradation.
21044957 2010 Identification of transmembrane protein 88 (TMEM88) as a dishevelled-binding protein.
20846493 2010 Coexpression and protein-protein complexing of DIX domains of human Dvl1 and Axin1 protein.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20412773 2010 The Hippo pathway regulates Wnt/beta-catenin signaling.
20388731 2010 Stability elements in the LRP6 cytoplasmic tail confer efficient signalling upon DIX-dependent polymerization.
20224554 2010 Binding of APC and dishevelled mediates Wnt5a-regulated focal adhesion dynamics in migrating cells.
20177058 2010 Myristoylated Naked2 antagonizes Wnt-beta-catenin activity by degrading Dishevelled-1 at the plasma membrane.
19956716 2009 Mutations in the human naked cuticle homolog NKD1 found in colorectal cancer alter Wnt/Dvl/beta-catenin signaling.
19643732 2009 A coated vesicle-associated kinase of 104 kDa (CVAK104) induces lysosomal degradation of frizzled 5 (Fzd5).
19625296 2009 Mutations in the LRRK2 Roc-COR tandem domain link Parkinson's disease to Wnt signalling pathways.
19561074 2009 Regulation of phosphatidylinositol kinases and metabolism by Wnt3a and Dvl.
19465938 2009 Inhibition of the Wnt/beta-catenin pathway by the WWOX tumor suppressor protein.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19388021 2009 Sequence requirement and subtype specificity in the high-affinity interaction between human frizzled and dishevelled proteins.
18760999 2008 Dishevelled-induced phosphorylation regulates membrane localization of Par1b.
18692936 2008 Dishevelled family proteins are expressed in non-small cell lung cancer and function differentially on tumor progression.
18632848 2008 SUMOylation target sites at the C terminus protect Axin from ubiquitination and confer protein stability.
18347071 2008 Nuclear Dvl, c-Jun, beta-catenin, and TCF form a complex leading to stabilization of beta-catenin-TCF interaction.
18162551 2008 Mechanism of activation of the Formin protein Daam1.
18093802 2008 Differential mediation of the Wnt canonical pathway by mammalian Dishevelleds-1, -2, and -3.
17593335 2007 Activation of p53 by Dishevelled independent of Wnt or planar polarity pathways.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16621789 2006 A dishevelled-1/Smad1 interaction couples WNT and bone morphogenetic protein signaling pathways in uncommitted bone marrow stromal cells.
16457155 Upregulation and overexpression of DVL1, the human counterpart of the Drosophila dishevelled gene, in prostate cancer.
15852005 2005 Inversin, the gene product mutated in nephronophthisis type II, functions as a molecular switch between Wnt signaling pathways.
15456783 2004 Independent mutations in mouse Vangl2 that cause neural tube defects in looptail mice impair interaction with members of the Dishevelled family.
15454084 2004 Mammalian Ryk is a Wnt coreceptor required for stimulation of neurite outgrowth.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15262978 2004 The DIX domain protein coiled-coil-DIX1 inhibits c-Jun N-terminal kinase activation by Axin and dishevelled through distinct mechanisms.
14750955 2003 Identification and characterization of a novel Dvl-binding protein that suppresses Wnt signalling pathway.
14747478 2004 The human Frizzled 6 (HFz6) acts as a negative regulator of the canonical Wnt. beta-catenin signaling cascade.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684739 2004 NEDL1, a novel ubiquitin-protein isopeptide ligase for dishevelled-1, targets mutant superoxide dismutase-1.
12941796 2003 BP75, bromodomain-containing M(r) 75,000 protein, binds dishevelled-1 and enhances Wnt signaling by inactivating glycogen synthase kinase-3 beta.
12883684 Up-regulation and overproduction of DVL-1, the human counterpart of the Drosophila dishevelled gene, in cervical squamous cell carcinoma.
12824876 2003 Amplification, up-regulation and over-expression of DVL-1, the human counterpart of the Drosophila disheveled gene, in primary breast cancers.
12805222 2003 Regulation of the Wnt signaling pathway by disabled-2 (Dab2).
12650946 2003 Identification of three novel Smad binding proteins involved in cell polarity.
12556519 2003 Casein kinase I epsilon enhances the binding of Dvl-1 to Frat-1 and is essential for Wnt-3a-induced accumulation of beta-catenin.
12533515 2003 Coactivation of Rac and Rho by Wnt/Frizzled signaling is required for vertebrate gastrulation.
12490194 2003 Runnin' with the Dvl: proteins that associate with Dsh/Dvl and their significance to Wnt signal transduction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11818547 2002 Casein kinase I phosphorylates and destabilizes the beta-catenin degradation complex.
11803455 2002 Identification of genomic organisation, sequence variants and analysis of the role of the human dishevelled 1 gene in late onset Alzheimer's disease.
11779461 2001 Wnt/Frizzled activation of Rho regulates vertebrate gastrulation and requires a novel Formin homology protein Daam1.
11742073 2001 beta-Arrestin1 modulates lymphoid enhancer factor transcriptional activity through interaction with phosphorylated dishevelled proteins.
11487578 2001 Axin-dependent phosphorylation of the adenomatous polyposis coli protein mediated by casein kinase 1epsilon.
11425858 2001 Synergistic activation of the Wnt signaling pathway by Dvl and casein kinase Iepsilon.
11113207 2001 Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein.
10806215 2000 Endogenous protein kinase CK2 participates in Wnt signaling in mammary epithelial cells.
10644691 2000 Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription.
10581192 1999 Identification of EPS8 as a Dvl1-associated molecule.
10428961 1999 Axin and Frat1 interact with dvl and GSK, bridging Dvl to GSK in Wnt-mediated regulation of LEF-1.
10330403 1999 Domains of axin involved in protein-protein interactions, Wnt pathway inhibition, and intracellular localization.
10330181 1999 DIX domains of Dvl and axin are necessary for protein interactions and their ability to regulate beta-catenin stability.
9482734 1998 Axin, a negative regulator of the Wnt signaling pathway, forms a complex with GSK-3beta and beta-catenin and promotes GSK-3beta-dependent phosphorylation of beta-catenin.
9344861 1997 cDNA cloning of a human dishevelled DVL-3 gene, mapping to 3q27, and expression in human breast and colon carcinomas.
9192851 1997 Human dishevelled genes constitute a DHR-containing multigene family.
8856345 Wnt-mediated relocalization of dishevelled proteins.
8817329 1996 cDNA characterization and chromosomal mapping of two human homologues of the Drosophila dishevelled polarity gene.
8644734 1996 Human homologue sequences to the Drosophila dishevelled segment-polarity gene are deleted in the DiGeorge syndrome.
8288125 1994 The Drosophila segment polarity gene dishevelled encodes a novel protein required for response to the wingless signal.