Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.85
PubTator Score 1.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Dupuytren Contracture 5
Disease Target Count P-value
facioscapulohumeral dystrophy 286 5.2e-19
Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 24 5.17 2.6

AA Sequence

MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIWFQNRRARH      1 - 70
GFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSREELAKEIGV     71 - 140
PESRVQIWFQNRRSRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGARTW          141 - 204
//

Text Mined References (3)

PMID Year Title
21732829 2011 Wnt signaling and Dupuytren's disease.
17005330 2007 Annotation, nomenclature and evolution of four novel homeobox genes expressed in the human germ line.
15057824 2004 The DNA sequence and biology of human chromosome 19.