Property Summary

NCBI Gene PubMed Count 39
PubMed Score 211.81
PubTator Score 48.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.058 3.2e-03
Multiple myeloma 1.719 6.7e-04
malignant mesothelioma 2.000 7.3e-08
osteosarcoma -2.334 9.0e-05
group 3 medulloblastoma 1.600 3.9e-05
tuberculosis 1.400 2.0e-06
pancreatic ductal adenocarcinoma liver m... 1.828 4.2e-03
intraductal papillary-mucinous carcinoma... 1.100 3.3e-02
intraductal papillary-mucinous neoplasm ... 1.600 4.3e-02
lung cancer 1.100 1.4e-02
active ulcerative colitis -1.016 4.4e-02
nasopharyngeal carcinoma 1.100 6.1e-04
gastric carcinoma 1.100 2.1e-02
ovarian cancer 2.700 8.2e-09

Gene RIF (17)

PMID Text
24311590 Comparison of the cellular distribution of wild-type dUTPase with those of hyperphosphorylation- and hypophosphorylation-mimicking mutants suggests that phosphorylation at Ser11 leads to the exclusion of dUTPase from the nucleus.
23894549 EBV-encoded dUTPase may act as an intercellular signaling molecule capable of modulating the cellular microenvironment
22944692 Positional proteomics analysis identifies the cleavage of human deoxyuridine triphosphatase (DUT) at amino acid residues 231-232 by the HIV-1 protease
22172489 Data sugget that inhibition of dUTPase is a mechanism-based therapeutic approach to significantly enhance the efficacy of thymidylate synthase (TS)-targeted chemotherapeutic agents.
21780905 Repression of dUTPase induced specific expression level increments for thymidylate kinase and thymidine kinase, and also an increased sensitization to 5-fluoro-2'-deoxyuridine and 5-fluoro-uracil.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20560137 High dUTP pyrophosphatase is associated with recurrence in colorectal cancer patients undergoing 5-fluorouracil adjuvant chemotherapy
19968781 nuclear dUTPase may be a good biomarker for predicting prognosis in HCC patients after surgical resection
19879316 significant differences between the human and Plasmodium dUTPases
19403629 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19302784 hinge proline destabilize human and Escherichia coli dUTPases without preventing trimeric organization
19015155 Establishment of a direct role for both mutant and wild-type forms of p53 in modulating dUTPase promoter activity.
17880943 determined the crystal structure of the enzyme:alpha,beta-imino-dUTP
17848562 kinetic model of the human dUTPase catalytic cycle
16325515 dUTPase staining provides a useful measure of cell proliferation distinct from that offered by Ki-67 labeling. It proved particularly useful for the evaluation of diffuse astrocytomas.
12799180 Nuclear dUTPase may contain a complex nuclear localization signal that is located throughout the entire protein.
12096336 Novel gain of function activity of p53 mutants: activation of the dUTPase gene expression leading to resistance to 5-fluorouracil.

AA Sequence

MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA      1 - 70
STVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYS     71 - 140
AYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE    141 - 210
VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN                                211 - 252
//

Text Mined References (48)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24311590 2013 Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23894549 2013 Epstein-Barr virus encoded dUTPase containing exosomes modulate innate and adaptive immune responses in human dendritic cells and peripheral blood mononuclear cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22172489 2012 Inhibition of dUTPase induces synthetic lethality with thymidylate synthase-targeted therapies in non-small cell lung cancer.
21780905 2011 Cellular response to efficient dUTPase RNAi silencing in stable HeLa cell lines perturbs expression levels of genes involved in thymidylate metabolism.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20560137 2011 Identification of potential pharmacogenomic markers of clinical efficacy of 5-fluorouracil in colorectal cancer.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19968781 2010 dUTP pyrophosphatase expression correlates with a poor prognosis in hepatocellular carcinoma.
19879316 2010 Kinetic properties and specificity of trimeric Plasmodium falciparum and human dUTPases.
19403629 2009 Polymorphisms in uracil-processing genes, but not one-carbon nutrients, are associated with altered DNA uracil concentrations in an urban Puerto Rican population.
19302784 2009 Molecular shape and prominent role of beta-strand swapping in organization of dUTPase oligomers.
19060904 2009 An empirical framework for binary interactome mapping.
19015155 2009 Regulation of human dUTPase gene expression and p53-mediated transcriptional repression in response to oxaliplatin-induced DNA damage.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17880943 2007 Active site closure facilitates juxtaposition of reactant atoms for initiation of catalysis by human dUTPase.
17848562 2007 Kinetic mechanism of human dUTPase, an essential nucleotide pyrophosphatase enzyme.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16325515 2005 Immunohistochemical detection of dUTPase in intracranial tumors.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15629463 2005 Modulation of human dUTPase using small interfering RNA.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12799180 2003 Identification of sequence determinants of human nuclear dUTPase isoform localization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374095 2001 The role of dUTPase and uracil-DNA repair in cancer chemotherapy.
12369926 2001 Homotrimeric dUTPases; structural solutions for specific recognition and hydrolysis of dUTP.
12096336 2002 Novel gain of function activity of p53 mutants: activation of the dUTPase gene expression leading to resistance to 5-fluorouracil.
11118321 2000 Altered subunit communication in subfamilies of trimeric dUTPases.
10910061 2000 dUTP nucleotidohydrolase isoform expression in normal and neoplastic tissues: association with survival and response to 5-fluorouracil in colorectal cancer.
9228092 1997 The human dUTPase gene encodes both nuclear and mitochondrial isoforms. Differential expression of the isoforms and characterization of a cDNA encoding the mitochondrial species.
9070952 1997 Assignment of the human dUTPase gene (DUT) to chromosome 15q15-q21. 1 by fluorescence in situ hybridization.
8910358 1996 Cloning and identification of rat deoxyuridine triphosphatase as an inhibitor of peroxisome proliferator-activated receptor alpha.
8805593 1996 Human dUTP pyrophosphatase: uracil recognition by a beta hairpin and active sites formed by three separate subunits.
8631817 1996 Identification of a consensus cyclin-dependent kinase phosphorylation site unique to the nuclear form of human deoxyuridine triphosphate nucleotidohydrolase.
8631816 1996 Characterization of distinct nuclear and mitochondrial forms of human deoxyuridine triphosphate nucleotidohydrolase.
8389461 1993 Maturation stage and proliferation-dependent expression of dUTPase in human T cells.
1325640 1992 Human dUTP pyrophosphatase: cDNA sequence and potential biological importance of the enzyme.
1091006 1975 [Method for plastic surgery of the small intestine after the resection of the esophagus and proximal portion of the stomach for cancer].