Property Summary

NCBI Gene PubMed Count 16
PubMed Score 17.43
PubTator Score 15.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 6.6e-59
malignant mesothelioma 3163 3.4e-07
medulloblastoma 1524 7.5e-05
adult high grade glioma 2148 1.6e-03

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.000 3.4e-07
medulloblastoma -1.100 7.5e-05
adult high grade glioma -1.100 1.6e-03
psoriasis 2.700 6.6e-59

Synonym

Accession Q99956 D3DWU5
Symbols MKP4
MKP-4

Gene

PDB

2HXP   3LJ8  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (8)

PMID Text
25998184 The results of this study, combined with previous studies, suggested that therapeutic intervention to increase the expression or activity of DUSP9 may enable the activation of anti-proliferation signals in malignant cells.
24838152 A possible use for DUSP9 as CIMP marker.
23276385 DUSP9 protein levels were markedly suppressed in severe pre-eclampsia, but not in severe IUGR. This suppression might be attributable to the prolonged hypoxic conditions found in pre-eclampsia.
23029454 The DUSP9 locus is a common susceptibility locus for type 2 diabetes across different ethnicities, and 6 loci identified in South Asian genome-wide association studies also have significant effect on susceptibility to Japanese type 2 diabetes.
21943117 decreased expression of DUSP-9 is associated with poor prognosis in ccRCC.
21908610 DUSP9/MKP-4 is a bona fide target of PKA signaling and attenuation of DUSP9/MKP-4 function can mediate cross-talk between the PKA pathway and MAPK signaling through both ERK1/2 and p38alpha in vivo
21206059 2.7 A resolution crystal structure of the catalytic domain of MKP-4 (MKP-4C) is presented
18006813 microtubule disruption by MKP4 provides a novel mechanism for tumor suppression by a cytosolic MKP

AA Sequence

MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLSVRALLPGPPL      1 - 70
QPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLAYYLQGGFSRFQAECPHLCET     71 - 140
SLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPN    141 - 210
LYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEAL    211 - 280
SQNCGVLVHCLAGVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERH    281 - 350
SQEQGSGGQASAASNPPSFFTTPTSDGAFELAPT                                        351 - 384
//

Text Mined References (20)

PMID Year Title
25998184 2015 Epigenetic silencing of DUSP9 induces the proliferation of human gastric cancer by activating JNK signaling.
24838152 2015 Development of a DUSP9 methylation screening assay.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23276385 2013 Dual specificity phosphatase 9 (DUSP9) expression is down-regulated in the severe pre-eclamptic placenta.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23029454 2012 A single nucleotide polymorphism within DUSP9 is associated with susceptibility to type 2 diabetes in a Japanese population.
22961080 2013 A genome-wide association study identifies GRK5 and RASGRP1 as type 2 diabetes loci in Chinese Hans.
21943117 2011 Decreased expression of dual-specificity phosphatase 9 is associated with poor prognosis in clear cell renal cell carcinoma.
21908610 2011 Phosphorylation of the kinase interaction motif in mitogen-activated protein (MAP) kinase phosphatase-4 mediates cross-talk between protein kinase A and MAP kinase signaling pathways.
21269460 2011 Initial characterization of the human central proteome.
21206059 2011 Exploring binding sites other than the catalytic core in the crystal structure of the catalytic domain of MKP-4.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18058037 2007 Structural genomics of protein phosphatases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006813 2007 Microtubule disruption and tumor suppression by mitogen-activated protein kinase phosphatase 4.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11988087 2002 Characterization of a murine gene encoding a developmentally regulated cytoplasmic dual-specificity mitogen-activated protein kinase phosphatase.
9030581 1997 Molecular cloning and functional characterization of a novel mitogen-activated protein kinase phosphatase, MKP-4.