Property Summary

NCBI Gene PubMed Count 16
PubMed Score 17.17
PubTator Score 15.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-03
group 4 medulloblastoma -1.100 9.5e-04
malignant mesothelioma 2.000 3.4e-07
psoriasis 2.700 6.6e-59

Gene RIF (8)

AA Sequence

MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLSVRALLPGPPL      1 - 70
QPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLAYYLQGGFSRFQAECPHLCET     71 - 140
SLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPN    141 - 210
LYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEAL    211 - 280
SQNCGVLVHCLAGVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERH    281 - 350
SQEQGSGGQASAASNPPSFFTTPTSDGAFELAPT                                        351 - 384
//

Text Mined References (20)

PMID Year Title