Property Summary

NCBI Gene PubMed Count 20
PubMed Score 661.70
PubTator Score 66.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.032 6.0e-05
adult high grade glioma -1.700 2.0e-06
astrocytic glioma -1.100 1.3e-02
atypical teratoid / rhabdoid tumor -3.000 1.0e-10
ependymoma -1.900 4.4e-02
glioblastoma -1.800 5.2e-08
lung adenocarcinoma -2.100 3.4e-10
lung carcinoma 2.500 5.3e-51

Gene RIF (8)

AA Sequence

MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLY      1 - 70
LGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRA     71 - 140
LSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLE    141 - 210
A//

Text Mined References (21)

PMID Year Title