Property Summary

NCBI Gene PubMed Count 19
PubMed Score 637.07
PubTator Score 66.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 1.3e-02
posterior fossa group A ependymoma -2.800 5.2e-19
glioblastoma -2.500 8.8e-05
atypical teratoid / rhabdoid tumor -3.000 1.0e-10
adrenocortical carcinoma -1.032 6.0e-05
pediatric high grade glioma -2.000 3.9e-06
lung adenocarcinoma -2.100 3.4e-10
lung carcinoma 2.500 5.3e-51

Synonym

Accession Q9BV47 D3DSV8 Q9BTW0
Symbols MKP8
NEAP
DSP-4
LDP-4
MKP-8
NATA1
SKRP3
DUSP24

Gene

PDB

2E0T   4B04   4HRF   5GTJ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
24548998 results suggest that AK2 is an associated activator of DUSP26 and suppresses cell proliferation by FADD dephosphorylation, postulating AK2 as a negative regulator of tumour growth.
23298255 The study reports the 1.68 A crystal structure of a catalytically inactive mutant (Cys152Ser) of DUSP26 lacking the first 60 N-terminal residues (DeltaN60-C/S-DUSP26).
20877624 Observational study of gene-disease association. (HuGE Navigator)
20562916 DUSP26 functions as a p53 phosphatase
20347885 DUSP26 may function as a tumour suppressor in particular cancers.
19043453 Downregulation of Dusp26 may contribute to malignant phenotypes of glioma.
16924234 DUSP26 effectively dephosphorylates p38 and has a little effect on extracellular signal-regulated kinase in anaplastic thyroid cancer.

AA Sequence

MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLY      1 - 70
LGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRA     71 - 140
LSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLE    141 - 210
A//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24548998 2014 The DUSP26 phosphatase activator adenylate kinase 2 regulates FADD phosphorylation and cell growth.
24155099 2014 Targeting DUSPs in glioblastomas - wielding a double-edged sword?
23695260 2013 High-resolution crystal structure of the catalytic domain of human dual-specificity phosphatase 26.
23298255 2013 Atomic structure of dual-specificity phosphatase 26, a novel p53 phosphatase.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20562916 2010 Dual-specificity phosphatase 26 is a novel p53 phosphatase and inhibits p53 tumor suppressor functions in human neuroblastoma.
20347885 2010 DUSP26 negatively affects the proliferation of epithelial cells, an effect not mediated by dephosphorylation of MAPKs.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19043453 2009 Protein phosphatase Dusp26 associates with KIF3 motor and promotes N-cadherin-mediated cell-cell adhesion.
19014381 2008 NEAP causes down-regulation of EGFR, subsequently induces the suppression of NGF-induced differentiation in PC12 cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17001450 2007 Characterization of a novel low-molecular-mass dual specificity phosphatase-4 (LDP-4) expressed in brain.
16924234 2007 A novel amplification target, DUSP26, promotes anaplastic thyroid cancer cell growth by inhibiting p38 MAPK activity.
16805799 2006 Biochemical and biological characterization of a neuroendocrine-associated phosphatase.
16581800 2006 Association and regulation of heat shock transcription factor 4b with both extracellular signal-regulated kinase mitogen-activated protein kinase and dual-specificity tyrosine phosphatase DUSP26.
15796912 2005 MKP-8, a novel MAPK phosphatase that inhibits p38 kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.