Property Summary

NCBI Gene PubMed Count 21
PubMed Score 11.52
PubTator Score 18.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.169 1.6e-04
ovarian cancer 1.600 1.6e-06
primitive neuroectodermal tumor -1.100 2.8e-02
tuberculosis 1.800 2.4e-09

Gene RIF (7)

AA Sequence

MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA      1 - 70
PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK     71 - 140
AVFQFYQRTK                                                                141 - 150
//

Text Mined References (24)

PMID Year Title