Property Summary

NCBI Gene PubMed Count 25
PubMed Score 47.44
PubTator Score 29.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
dermatomyositis 1.400 1.2e-03
group 3 medulloblastoma -1.400 3.8e-04
malignant mesothelioma 1.400 3.3e-07
medulloblastoma, large-cell -1.700 1.3e-05
non-small cell lung cancer -1.142 1.5e-19
osteosarcoma -1.601 8.1e-05
ovarian cancer 1.500 1.5e-04
pituitary cancer -1.400 3.5e-07
tuberculosis 1.100 5.2e-09
ulcerative colitis 1.100 2.0e-04

Gene RIF (13)

AA Sequence

MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKES      1 - 70
IKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEK     71 - 140
HEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL                              141 - 184
//

Text Mined References (27)

PMID Year Title