Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.50
PubTator Score 4.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
gastric carcinoma 807 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
gastric carcinoma -1.200 1.1e-02

Gene RIF (3)

AA Sequence

MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIK      1 - 70
PWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAK     71 - 140
RKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCD    141 - 210
RIQENSS                                                                   211 - 217
//

Text Mined References (13)

PMID Year Title