Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.63
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MTEGVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINF      1 - 70
IHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASS     71 - 140
QKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATGRTAQRCRLSPRAAAERLLGPPPHVAAG    141 - 210
WSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQC    211 - 280
SCLHPKRAASSSCTR                                                           281 - 295
//

Text Mined References (14)

PMID Year Title