Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.20
PubTator Score 6.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.300 7.9e-03
chronic rhinosinusitis -1.316 1.6e-02
colon cancer 1.100 1.1e-04
glioblastoma -1.200 3.0e-03
group 4 medulloblastoma -1.200 1.5e-03
intraductal papillary-mucinous adenoma (... -1.400 3.0e-04
intraductal papillary-mucinous carcinoma... -1.200 7.7e-04
invasive ductal carcinoma -1.244 2.3e-03
medulloblastoma, large-cell -1.300 5.2e-03
ovarian cancer 1.400 1.4e-04
primitive neuroectodermal tumor -1.400 1.5e-03
psoriasis 1.600 1.6e-04
spina bifida -2.249 3.6e-02
ulcerative colitis 1.200 1.6e-03

Gene RIF (8)

AA Sequence

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQ      1 - 70
FEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW     71 - 140
VKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI                141 - 198
//

Text Mined References (17)

PMID Year Title