Property Summary

NCBI Gene PubMed Count 19
PubMed Score 56.31
PubTator Score 16.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 5.6e-04
lung cancer 4473 1.1e-03
primitive neuroectodermal tumor 3031 2.0e-03
glioblastoma 5572 7.0e-03
Multiple myeloma 1327 3.4e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.195 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.091 3.4e-02
glioblastoma 1.100 7.0e-03
primitive neuroectodermal tumor 1.100 2.0e-03
lung cancer 2.000 1.1e-03
group 3 medulloblastoma 1.400 5.6e-04

Gene RIF (11)

PMID Text
21556130 propose that the BRC repeats in BRCA2 cooperate in a partially redundant but reinforcing manner to ensure a high probability of RAD51 filament formation
21521943 hYVH1 is a novel modulator of cell cycle progression mediated by a phosphorylation site located at the C-terminal end of the zinc-binding domain
21211013 these data suggests common SNPs within DUSP12-ATF6 locus may not play a major role in glucose metabolism in the Chinese.
20103624 tudies confirmed elevated expression of three target antigens RAB38, TBCE, and DUSP12 in CML.
19567874 Data determined that hYVH1 forms intramolecular disulfide bonds at the catalytic cleft as well as within the zinc binding domain to avoid irreversible inactivation during severe oxidative stress.
19087671 Observational study of gene-disease association. (HuGE Navigator)
18973475 hYVH1 is a novel cell survival phosphatase that co-operates with Hsp70 to positively affect cell viability in response to cellular insults.
18854154 Knockdown of dual specificity phosphatase 12 (DUSP12) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18269685 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16936214 Observational study of gene-disease association. (HuGE Navigator)
16936214 Our data suggest that sequences in or upstream of DUSP12 may contribute to type 2 diabetes susceptibility, but the lack of replication suggests a small effect size.

AA Sequence

MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGP      1 - 70
GVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEK     71 - 140
AYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVS    141 - 210
QGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESAL    211 - 280
LGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI              281 - 340
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21556130 2011 Characterization of a human cell line stably over-expressing the candidate oncogene, dual specificity phosphatase 12.
21521943 2011 The dual-specificity phosphatase hYVH1 (DUSP12) is a novel modulator of cellular DNA content.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21211013 2011 Lack of association between genetic polymorphisms within DUSP12 - ATF6 locus and glucose metabolism related traits in a Chinese population.
20103624 2010 Efficacious immune therapy in chronic myelogenous leukemia (CML) recognizes antigens that are expressed on CML progenitor cells.
19567874 2009 Redox regulation of the human dual specificity phosphatase YVH1 through disulfide bond formation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19087671 2008 [Association of -6735T-->C variant of glucokinase-associated dual-specificity phosphatase 12 gene with type 2 diabetes in Chinese].
18973475 2009 The dual-specificity phosphatase hYVH1 interacts with Hsp70 and prevents heat-shock-induced cell death.
18269685 2008 Type 2 diabetes susceptibility genes on chromosome 1q21-24.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16936214 2006 Polymorphisms in the glucokinase-associated, dual-specificity phosphatase 12 (DUSP12) gene under chromosome 1q21 linkage peak are associated with type 2 diabetes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10446167 1999 Identification of the human YVH1 protein-tyrosine phosphatase orthologue reveals a novel zinc binding domain essential for in vivo function.
8670865 1996 Differential regulation of the MAP, SAP and RK/p38 kinases by Pyst1, a novel cytosolic dual-specificity phosphatase.