Property Summary

NCBI Gene PubMed Count 13
PubMed Score 21.73
PubTator Score 15.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
primary Sjogren syndrome 1.100 9.3e-03
psoriasis 1.500 1.2e-04

Synonym

Accession O75319 B2RCT8 Q6AI47 Q9BWE3
Symbols PIR1

Gene

PANTHER Protein Class (2)

PDB

4JMJ   4MBB   4NYH  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEEC      1 - 70
FSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKE     71 - 140
NKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRKNWNS    141 - 210
SVPRSSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQSVRKFSENPHVYQRHHLP    211 - 280
PPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEWTQ                        281 - 330
//

Text Mined References (17)

PMID Year Title