Property Summary

NCBI Gene PubMed Count 36
PubMed Score 35.89
PubTator Score 24.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.700 4.9e-06
oligodendroglioma -1.300 4.3e-02
psoriasis -1.500 1.9e-03
Amyotrophic Lateral Sclerosis 1.074 4.2e-07
tuberculosis and treatment for 3 months -2.200 1.2e-06
active Crohn's disease 1.809 3.8e-03
active ulcerative colitis 2.092 4.4e-03
diabetes mellitus -1.400 7.2e-03
sonic hedgehog group medulloblastoma 1.100 1.2e-02
invasive ductal carcinoma 1.311 9.2e-03
gastric carcinoma 1.900 4.4e-03
mucosa-associated lymphoid tissue lympho... -1.218 3.0e-02
ductal carcinoma in situ 1.300 7.3e-03
acute myeloid leukemia 1.500 5.8e-03
ovarian cancer 1.300 5.0e-03
pituitary cancer 1.100 5.2e-03

Protein-protein Interaction (4)

Gene RIF (19)

PMID Text
25973098 In females, three SNPs were associated with decreased colorectal cancer risk: rs11118838, rs12724393, and rs908858. However, in males, only one SNP, rs908858, was associated with decreased colorectal cancer risk.
25772234 Increased Dusp10 expression is associated with better survival rate in colorectal cancer patients.
24975273 Data suggest that vitamin D receptor target genes (DUSP10; THBD, thrombomodulin; NRIP1, nuclear receptor interacting protein 1; TRAK1, trafficking protein kinesin binding 1) can be used as markers for individual's response to vitamin D3 supplements.
23993976 Depletion of miR-181 family members by miRNA inhibitors enhanced the expression of MKP-5 and suppressed the phosphorylation of p38 MAPK after exposure to PAHs, which promotes cancer cell migration.
23936387 Single nucleotide polymorphism in DUSP10 gene is associated with celiac disease.
23872954 Certain mutations in DUSP10 correlate with the incidence of colorectal cancer(CRC). Thus, the function of the DUSP10 gene product may contribute toward CRC in the Han Chinese population.
23233447 Data indicate that the activities of phosphoprotein phosphatases MKP5 and MKP7 were determined in the system.
22711061 MKP-5 interacts with ERK, retains it in the cytoplasm, suppresses its activation and downregulates ERK-dependent transcription.
22375048 A distinct interaction mode revealed by the crystal structure of the kinase p38alpha with the MAPK binding domain of the phosphatase MKP5.
22245064 DUSPs 10 and 16 are positive regulators of activation, apparently acting by modulating cross-talk between the p38 and ERK pathways.
21487011 a function for ASC that is distinct from the inflammasome in modulating MAPK activity and chemokine expression and further identify DUSP10 as a novel ASC target.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18314537 p38 MAP kinase down-regulates extracellular signal-regulated kinase via activation of MKP-3 in human monocytes exposed to asbestos to enhance TNF-alpha gene expression.
17681939 The transcription factor ATF2, which is phosphorylated and activated by JNK, is a critical mediator for inducible expression of DUSP1 and DUSP10 in this signaling pathway.
17400920 Catalytic domain of MKP5 is in an active conformation, and two loops in the active site have backbone shifts of up to 5 A.
17151092 Mitogen-activated protein kinase phosphatase-5 (MKP5) mediates anti-inflammatory activities of phytochemicals curcumin, resveratrol and [6]-gingerol.
16806267 Structural information provides an explanation of constitutive activity of MKP5 as well as the structural insight into substrate-induced activation occurred in other MKPs.

AA Sequence

MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSANPGSNSHPPVIATTVVSLKAANLTYMPSSSGSARS      1 - 70
LNCGCSSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNNNENTGSLSPSSGVGSPVSGT     71 - 140
PKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKI    141 - 210
TVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNH    211 - 280
ENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGY    281 - 350
VINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI    351 - 420
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV            421 - 482
//

Text Mined References (37)

PMID Year Title
25973098 2015 Polymorphisms in the DUSP10 gene are associated with sex-specific colorectal cancer risk in a Han population.
25772234 2016 DUSP10 regulates intestinal epithelial cell growth and colorectal tumorigenesis.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
24975273 2014 Changes in vitamin D target gene expression in adipose tissue monitor the vitamin D response of human individuals.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
23993976 2013 Polycyclic aromatic hydrocarbon (PAH)-mediated upregulation of hepatic microRNA-181 family promotes cancer cell migration by targeting MAPK phosphatase-5, regulating the activation of p38 MAPK.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23872954 2014 DUSP10 gene polymorphism and risk of colorectal cancer in the Han Chinese population.
23233447 2013 A high-throughput assay for phosphoprotein-specific phosphatase activity in cellular extracts.
22711061 2012 Novel function of MKP-5/DUSP10, a phosphatase of stress-activated kinases, on ERK-dependent gene expression, and upregulation of its gene expression in colon carcinomas.
22375048 2011 A distinct interaction mode revealed by the crystal structure of the kinase p38? with the MAPK binding domain of the phosphatase MKP5.
22245064 2012 Dual specificity phosphatases 10 and 16 are positive regulators of EGF-stimulated ERK activity: indirect regulation of ERK signals by JNK/p38 selective MAPK phosphatases.
21487011 2011 The NLR adaptor ASC/PYCARD regulates DUSP10, mitogen-activated protein kinase (MAPK), and chemokine induction independent of the inflammasome.
20972440 2010 Meta-analysis of three genome-wide association studies identifies susceptibility loci for colorectal cancer at 1q41, 3q26.2, 12q13.13 and 20q13.33.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18314537 2008 Asbestos-induced MKP-3 expression augments TNF-alpha gene expression in human monocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17681939 2007 Several dual specificity phosphatases coordinate to control the magnitude and duration of JNK activation in signaling response to oxidative stress.
17400920 2007 Crystal structure of the MAP kinase binding domain and the catalytic domain of human MKP5.
17151092 2007 Chemopreventive anti-inflammatory activities of curcumin and other phytochemicals mediated by MAP kinase phosphatase-5 in prostate cells.
16806267 2006 Crystal structure of the catalytic domain of human MAP kinase phosphatase 5: structural insight into constitutively active phosphatase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11359773 2001 A Novel MAPK phosphatase MKP-7 acts preferentially on JNK/SAPK and p38 alpha and beta MAPKs.
11060451 2000 Expression and comparative chromosomal mapping of MKP-5 genes DUSP10/Dusp10.
10597297 1999 MKP5, a new member of the MAP kinase phosphatase family, which selectively dephosphorylates stress-activated kinases.
10391943 1999 Molecular cloning and characterization of a novel dual specificity phosphatase, MKP-5.
9628821 1998 Identification of sequence-tagged transcripts differentially expressed within the human hematopoietic hierarchy.
9571625 1998 The "VH1-like" dual-specificity protein tyrosine phosphatases.