Property Summary

NCBI Gene PubMed Count 165
PubMed Score 767.86
PubTator Score 327.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (33)

Disease log2 FC p
Rheumatoid Arthritis 1.500 8.2e-04
gastric cancer -2.600 1.2e-03
hepatocellular carcinoma -1.500 1.3e-02
pancreatic cancer -2.400 4.8e-03
Waldenstrons macroglobulinemia 1.549 2.2e-02
urothelial carcinoma -2.900 1.8e-03
malignant mesothelioma -1.500 4.4e-07
psoriasis -2.400 8.9e-16
chronic lymphosyte leukemia -2.000 2.9e-07
astrocytoma 2.000 5.6e-03
glioblastoma 2.600 8.8e-04
medulloblastoma, large-cell -1.200 1.4e-02
limb girdle muscular dystrophy 2I 1.156 1.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.018 3.7e-02
acute quadriplegic myopathy 1.177 1.5e-03
adrenocortical carcinoma -1.178 3.7e-03
non-small cell lung cancer -1.968 2.1e-23
intraductal papillary-mucinous adenoma (... -1.800 2.4e-04
intraductal papillary-mucinous carcinoma... -2.100 7.3e-04
intraductal papillary-mucinous neoplasm ... -1.800 2.0e-03
lung cancer -2.900 1.3e-06
colon cancer -2.500 1.3e-02
fibroadenoma -2.100 1.8e-02
lung adenocarcinoma -1.400 5.0e-04
pancreatic carcinoma -2.400 4.8e-03
nasopharyngeal carcinoma -1.900 1.4e-03
inflammatory breast cancer -4.800 1.3e-09
lung carcinoma -1.500 2.5e-12
pterygium -2.000 1.0e-02
ovarian cancer -1.700 8.6e-03
pituitary cancer -2.600 2.0e-07
Down syndrome 1.100 8.5e-03
chronic rhinosinusitis -1.207 5.0e-02

Synonym

Accession P28562 D3DQL9 Q2V508
Symbols HVH1
MKP1
CL100
MKP-1
PTPN10

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
374 screening 100 / 115 / 65024 In vitro Primary HTS Assay for MKP-1
442 confirmatory 6 / 0 / 0 In vitro MKP-1 Phosphatase Dose Response Confirmation and Secondary Selectivity/Specificity Assay
551 confirmatory 49 / 0 / 69 In vitro MKP-1 Phosphatase HTS Dose Response Confirmation Assay
558 confirmatory 33 / 0 / 25 In vitro MKP-1 Phosphatase Dose Response Active/Probe Assessment Assay - Effects of DTT
562 confirmatory 33 / 0 / 25 In vitro MKP-1 Phosphatase Dose Response Active/Probe Assessment Assay - Effects of Catalase
563 confirmatory 41 / 0 / 17 In vitro MKP-1 Phosphatase Dose Response Active/Probe Assessment Assay - Reproducibility testing
674 confirmatory 11 / 0 / 18 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment: MKP-1 Dose Response Selectivity comparison.

Gene RIF (148)

PMID Text
26769965 The heparin effects on TNFalpha-induced stress fiber formation and Map kinase signaling depend on increased DUSP1 expression.
26689986 In E1a expressing non-small cell lung carcinoma cells, upregulation of MKP1 and the subsequent p38MAPK inhibition is required for the induction of chemosensitivity to cisplatin.
26546680 DUSP1 overexpression and inhibition of MAPKs prevented IL1B-induced expression of ZFP36, this was associated with increased TNF mRNA expression at 6 h, an effect that was predominantly due to elevated transcription.
26329166 MKP-1 can attenuate tamoxifen-induced cell death through inhibiting the JNK signal pathway.
26280733 Progesterone acts via GR to drive MKP-1 expression, which in turn inhibits IL-1beta-dependent c-Jun activation and COX-2 expression.
26176177 evidence of association between depressive symptom severity and increasing serum MKP-1 levels in women, and decreasing T levels in perimenopausal women.
26158762 Data show that sorafenib inhibited microRNA miR-101 expression and enhanced dual specificity phosphatase 1 (DUSP1) expression and lowered transforming growth factor beta I (TGF-beta) release in M2 macrophage, slowing macrophage-driven hepatocarcinoma.
26111828 MKP1 recruits to the chromatin in response to DNA damage and correlates with the decrease of H3S10P, whereas MKP1 is released from chromatin during recovery phase of DNA damage response.
25943894 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of MKP-1
25872469 The proliferation of human cervical cancer cells was also inhibited by DUSP1
25858560 Data (including data from studies in knockout mice) suggest AMPK activation (AMPKa1 or AMPKa2) suppresses inflammation in vascular smooth muscle cells by down-regulation of STAT1 signaling and up-regulation of MKP-1 (dual specificity phosphatase 1).
25798824 DUSP1 is involved in the antiviral host defense mechanism against a HCV infection
25724669 MKP-1 is a MAPK deactivator; thus, by controlling p38 MAPK phosphorylation status in a temporally distinct manner, MKP-1 ensures that TTP is expressed and made functional at precisely the correct time to repress cytokine expression.
25638726 Deregulation of EGR-1 and/or DUSP-1 in nasal epithelium could be responsible for the prolonged activated transcriptional state observed in vivo in allergic disease.
25617504 Wild-type but not mutant p53 transcriptionally upregulated DUSP1 via its DNA-binding domain. DUSP1 and p53 might collaborate to suppress tumors in hepatocarcinogenesis via a positive regulatory loop.
25593344 Decreased DUSP1 might be a mechanism responsible for gefitinib resistance.
25389768 CYLD negatively regulates nontypeable Haemophilus influenzae-induced IL-8 expression via MKP-1-dependent inhibition of ERK.
25377473 Combined inhibition of MKP1 and HER2 enhanced cell killing in breast cancer. Together, our findings identify a new mechanism of resistance in breast tumors and reveal MKP1 as a novel therapeutic target for radiosensitization.
25370852 DUSP1 upregulation is strongly linked to adiposity and that physical exercise modulates its expression.
25312268 Together, our results clearly establish the role of Dusp1 as a tumor suppressor gene that regulates cancer-associated inflammation.
25296132 PDE4 inhibitors augment antiinflammatory effects of beta2-agonists via increased MKP-1 expression in airway smooth muscle cells.
25204653 MKP-1 and MKP-2 stability is regulated by ERK-mediated phosphorylation through a degradation pathway independent of polyubiquitination
25044272 Knockdown of MKP-1 abolished the miR-210-inhibition prevention of cell proliferation under hypoxia.
24692548 DUSP1 plays a transient, often partial, role in the dexamethasone-dependent repression of certain inflammatory genes.
24658355 Data suggest that MKP-2 rather than MKP-1 is tamoxifen-regulated and that the elevated expression of MKP-2 in MCF7-TAMR cells potentially functions to restore tamoxifen sensitivity.
24578378 MKP-1 promoted angiogenic and arteriogenic neovascular growth, potentially through dephosphorylation of histone H3 serine 10 on coding-region DNA to control transcription of angiogenic genes, such as fractalkine.
24339725 Keratoconic corneas are distinguished with high expression of TGF-beta1 and DUSP1.
24308939 DUSP1, DUSP4, and DUSP5 differentially modulate endothelial MAPK signaling pathways downstream of Tie-2 receptors.
24267255 DUSP1 expression is increased in obstructive sleep apnea and intermittent hypoxia
24155659 Our approaches revealed signature candidates of differentially hypermethylated genes of DDAH2 and DUSP1 which can be further developed as potential biomarkers for OSCC as diagnostic, prognostic and therapeutic targets in the future.
24086554 Activating MAPK phosphatase-1 (MKP-1).
24080497 DUSP1 promotes apoptosis in prostate cancer cells through the inhibition of p38 MAPK.
23825193 Authors showed that phosphorylation-dependent activation of p38 mitogen-activated protein kinase (MAPK) and translation disruption of TNF-alpha and IL-6 follow increased MAPK phosphatase 1 (MKP-1) expression.
23728617 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of MKP-1
23625220 Pneumolysin produced by Streptococcus pneumoniae is required for inducing hos beta-defensin 2 whose expression is under the control of p38 MAP and MKP1.
23333304 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of MKP-1
23169297 Downregulation of DUSP1 mRNA is associated with prostate cancer.
23149933 DJ-1 downregulates DUSP1 expression under conditions of oxidative stress.
23097457 These data reveal an indirect role for miR-K12-11 of Kaposi's sarcoma-associated herpesvirus in the regulation of DUSP1 and downstream pathogenesis.
23030431 MKP-1 suppressed Tristetraprolin expression by inhibiting p38 MAPK pathway.
22991462 Data indicate that knockdown of MKP-1 mimicked the priming effects of metabolic stress.
22924482 In lesional psoriatic skin, the p38 MAPK negative feedback mechanism provided by DUSP1 seems to be inhibited and downregulation of DUSP1 may contribute to the sustained inflammatory response seen in psoriasis.
22743041 By increasing MKP-1 expression via parallel p38 MAPK- and CREB-mediated pathways, S1P temporally regulates MAPK signaling pathways by upregulating the negative feedback controller MKP-1.
22610099 PDE4B mediates ERK-dependent up-regulation of mucin MUC5AC by S. pneumoniae by inhibiting cAMP-PKA-dependent MKP-1 pathway.
22301548 Upon vitamin D treatment, the expression of MKP-1 phosphatase mRNA and protein is significantly upregulated in both human monocytes and murine bone marrow-derived macrophages.
22200679 MKP-1: a negative feedback effector that represses MAPK-mediated pro-inflammatory signaling pathways and cytokine secretion in human airway smooth muscle cells.
22020934 Findings suggest that MKP-1 is a critical mediator of anti-proliferative and anti-inflammatory actions of PR in the breast.
22014408 S-nitrosylation of MKP-1 presents a novel mechanism underlying the enhanced MKP-1 expression levels and MKP-1-mediated radio-resistance in head and neck cancer.
21960346 The imbalanced expression of MKP-1 and p-ERK(1/2) may play a role in the development of squamous cell carcinoma (SCC) and these two molecules may be new targets for the therapy and prognosis of SCC.
21959016 infectious bronchitis virus (IBV) infection of cultured cells activated p38 MAPK pathway and induced expression of IL6 and IL8; IBV has developed a strategy to counteract induction of IL6 and IL8 by inducing expression of dual-specificity phosphatase 1
21840882 Tauroursodeoxycholate inhibits neointimal hyperplasia by reducing proliferation and inducing apoptosis of smooth muscle cells by suppression of ERK via PKCalpha-mediated MKP-1 induction.
21803700 Dexamethasone treatment inhibits cisplatin-induced cell apoptosis by up-regulation of cellular mitogen-activated protein kinase phosphatase-1.
21733716 work provides new mechanistic insight of MKP-1 signaling and regulation of cytokine mRNA stability through RNA binding proteins in response to inflammatory stimuli
21715333 T-LAK cell-originated protein kinase (TOPK) phosphorylation of MKP1 protein prevents solar ultraviolet light-induced inflammation through inhibition of the p38 protein signaling pathway.
21610072 ERK cascade can act as a coincidence detector to decode the simultaneous engagement of a receptor tyrosine kinase and of LRP-1 and as a signal integrator that encodes this information in a spatially and temporally distinct biological signal
21547253 Results indicate that DUSP1 suppresses iNOS expression by limiting p38 MAPK activity in human and mouse cells.
21507959 CK2 enhances the protein level and activity of TTP via the modulation of the MKP-1-p38 MAPK signaling pathway; TGF-beta1 enhances the activity of CK2
21454676 Down-regulation of cytokine-induced interleukin-8 requires inhibition of p38 mitogen-activated protein kinase (MAPK) via MAPK phosphatase 1-dependent and -independent mechanisms.
21060794 transcriptional activation of DUSP1 by glucocorticoids requires p300 and a rapid modification of the chromatin structure surrounding the GRE
20953200 MKP-1 is identified as a key factor in major depressive disorder pathophysiology.
20890299 these results provide evidence for a role of DUSP1 in angiogenesis, invasion and metastasis in non-small-cell lung cancer.
20868379 study reveals novel roles of pneumolysin in mediating MKP1 expression for the regulation of proinflammatory cytokine expression in a time-dependent manner
20829434 Results propose a MIF-NURR1 signaling axis as a regulator of the glucocorticoid sensitivity of MKP1.
20805296 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20803086 regulates the induction of Monocyte Chemotactic Protein 1 by Streptococcus pneumoniae pneumolysin in epithelial cells
20708668 We propose DUSP1 as a novel target gene of DON, which is essential for the prevention of DON induced apoptosis in the epithelial cell line HepG2.
20689807 Observational study of gene-disease association. (HuGE Navigator)
20673984 The DUSP1 polymorphisms rs881152 and rs34507926 localized to different haplotype blocks and appeared to significantly modify the relationship between Inhaled corticosteroid use and bronchodilator response among GALA study participants
20673984 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20672047 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of MKP-1
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20555314 NF-kB-mediated induction contributes to establishment of tolerance to TLR ligands in enterocytes
20375469 player in the regulation of metabolic homeostasis in skeletal muscle and mitochondrial dysfunction caused by overnutrition
20353815 Ritonavir (at 100 mg once daily and 100 mg twice daily significantly down-regulated dual specificity phosphatase 1 in 20 healthy individuals.
20228065 generation of ROS by Nox4 mediates TGF-beta1-induced PAI-1 gene expression at least in part through oxidative modification and inhibition of MKP-1 leading to a sustained activation of JNK and p38 MAPKs.
20145951 molecular cross-talk between the MKP-1, p38 MAPK and PI3K pathways promotes resistance to PI3K inhibitors in hilar cholangiocarcinoma cells.
20100830 VCP/p97-mediated inducible nitric-oxide synthase-dependent Tyr nitration of PP2A increases the levels of phosphatases PP2A and DUSP1 to contribute to the refractory response of conditioned cells
20089808 MKP-1 is an important negative regulator of inflammatory gene expression in human pulmonary epithelial cells.
20043958 Results demonstrate that MG-132 upregulates MKP-1 and represses cytokine secretion from ASM and highlight the potential of the proteasome as a therapeutic target in asthma.
19940143 a novel glucocorticoid-responsive region of the human DUSP1 gene contains a highly unusual element, in which three closely spaced GR half-sites are required for potent transcriptional activation
19913121 Observational study of gene-disease association. (HuGE Navigator)
19797979 These data strongly suggest that MKP-1 is a major effector in altering ERK1/2 phosphorylation status.
19793766 hypothermia protects against TNF-alpha-induced endothelial barrier dysfunction and apoptosis through an MKP-1-dependent mechanism.
19755862 The expression of mitogen-activated protein kinase phosphatase-1 (MKP-1)is associated with cisplatin resistance in ovarian cancer cells.
19724859 CTGF and DUSP1 overexpression in residual breast cancer samples may be a reflection of resistance to further administration of doxorubicin/cyclophosphamide regimen
19697705 The abnormal expression of MKP-1 and p-ERK(1/2) probably assists in promoting the development and progression of ovarian carcinoma.
19648110 Data reveal an important and novel role for transcriptional activation (transactivation) of MKP-1 in the repression of NF-kappaB-dependent transcription by glucocorticoids.
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19553005 Data show that inhibition of NF-kappaB or PI3K potently enhanced cisplatin cytotoxicity in cells with endogenous or genetically induced low MKP1 levels.
19417026 Data show that MKP-1 is overexpressed during the malignant transformation of the breast and independently predicts poor prognosis.
19411256 KLF5 promotes breast cell survival partially through fibroblast growth factor-binding protein 1-pERK-mediated dual specificity MKP-1 protein phosphorylation and stabilization.
19262425 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19032224 The MAP kinase phosphatase-1 MKP-1/DUSP1 is a regulator of human liver response to transplantation.
19020052 Histone H3 as a novel substrate for MAP kinase phosphatase-1.
18782768 pneumolysin selectively induced expression of MKP1 via a TLR4-dependent MyD88-TRAF6-ERK pathway, which inhibited the PAK4-JNK signaling pathway,leading to up-regulation of MUC5AC mucin production
18726921 High level of mitogen-activated protein kinase phosphatase-1 expression is associated with cisplatin resistance in osteosarcoma
18723442 whether MAP kinase phosphatase (MKP)-1, a negative regulator of p38 and JNK, mediates the antiinflammatory effects of shear stress.
18519678 DUSP1 reactivation led to suppression of ERK, CKS1, and SKP2 activity, inhibition of proliferation and induction of apoptosis in human hepatoma cell lines
18490444 MKP-1 upregulation by oxidative stress is potently influenced by increased mRNA stability and translation, mediated at least in part by the RNA-binding proteins HuR and NF90.
18477563 phosphorylated heat shock protein 27 up-regulated the levels of p38 mitogen-activated protein kinase and mitogen-activated protein kinase phosphatase-1, an inhibitory protein of extracellular signal-regulated kinase
18441094 Glucocorticoid regulation of CD38 expression in human airway smooth muscle cells: role of dual specificity phosphatase 1
18434324 distinct phosphorylation of PKCdelta on tyrosines 64 and 187 specifically activates the Erk1/2 pathway by the down-regulation of MKP-1, resulting in the persistent phosphorylation of Erk1/2 and cell apoptosis
18403641 These findings indicate that p53 is a transcriptional regulator of DUSP1 in stress responses.
18367666 overexpression of MKP-1 has no significant effect on Ton EBP/OREBP activity. This paradox is explained by opposing effects of p38alpha and p38delta, both of which are activated by high NaCl and inhibited by MKP-1.
18314542 corticosteroid-induced MKP-1 contributes to the repression of IL-6 secretion in ASM cells.
18178562 a novel, stimulus-specific, and phosphatase-specific mechanism of ERK2 regulation in the nucleus by DUSP1, -2, and -4.
18095520 in patients with rheumatic heart disease and heart failure MKP-1 activity was depressed in class IV patients compared to those in classes II and III
18089824 MKP-1 plays a critical role in ERK-mediated cisplatin resistance in ovarian carcinoma cells.
18003751 Distinct MAPK signaling pathways for thrombin versus VEGF induction of MKP-1 in endothelial cells. MKP-1 induction important in VEGF-stimulated endothelial cell migration.
17848570 Ethanol-induced oxidative stress enhanced the tyrosine phosphorylation of PKCdelta, which in turn caused the proteasomal degradation of MKP-1, leading to sustained JNK activation and increased apoptosis in VL-17A cells.
17761948 Regulation of ERK by MKP-1 provides a novel mechanism for control of osteoblast proliferation by glucocorticoids
17690186 Data suggest that JNK activation and decreased expression of MKP-1 may play important roles in progression of urothelial carcinoma.
17681939 The transcription factor ATF2, which is phosphorylated and activated by JNK, is a critical mediator for inducible expression of DUSP1 and DUSP10 in this signaling pathway.
17638884 E2F-1 is a transcriptional activator of DUSP1 and DUSP1 is a link between E2F-1 and MAP kinases
17560945 Knockdown of dual specificity protein phosphatase 1 (DUSP1) by siRNAs significantly enhances HIV-1 replication in human acute monocytic leukemia cells
17489738 In human mesangial cells, connective tissue growth factor induces the rapid transcriptional activation and synthesis of MKP-1 (MAPK phosphatase-1), a dual specificity phosphatase that dephosphorylates p38 MAPK.
17131384 These results suggest the existence of an ERK1/2-driven negative feed-back regulation of ERK5 signaling in epidermal growth factor-stimulated HK-2 cells, which is mediated by MKP-3, DUSP5 and/or MKP-1.
17073741 DUSP1 is a central regulator of innate immunity, and its expression can profoundly affect the outcome of inflammatory challenges.[review]
16951204 MKP-1 is required for cisplatin resistance in tumor cells.
16387640 Anandamide-induced rapid MKP-1 expression switches off MAPK signal transduction in microglial cells activated by stimulation of pattern recognition receptors.
16293973 The MKP-1 expression in HCC (hepatocellular carcinoma) was an independent prognostic factor for outcome in HCC patients.
16289033 data suggest that MKP-1, a negative regulator of ERK1/2, plays a proapoptotic role in oxidative stress-induced cell death in neuroblastoma SH-SY5Y cell line
16286470 MKP-1 proteolysis can be achieved via ERK and SCF(Skp2) cooperation, thereby sustaining ERK activation
16224818 A molecular target of macrophage migration inhibitory factor - glucocorticoid crosstalk.
16109884 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of MKP-1
16081065 Hypoxia-induced MKP-1 protects overactivation of hypoxia-inducible factor 1 activation through inhibiting ERK kinase activity.
16044158 DNA damage in transcribed genes induces apoptosis via the JNK pathway and MKP-1.
15677475 preheating accelerates MAP kinase inactivation after a second heat shock, which is related to a HSP70-mediated increase in p-MKP-1
15614136 MKP-1 is an important mediator of endotoxin tolerance via p38 regulation
15590693 Glucocorticoid receptor-induced MPK-1 expression inhibits paclitaxel-associated MAPK activation and contributes to breast cancer cell survival
15569826 Rat ANP induces MKP-1 via endothelial Rac1 and Nox/Nox2.
15448190 MKP-1 induction may be antiapoptotic om breast epithelial cells and a breast cancer cell line.
15339908 expression of the CL-100 phosphatase and its subsequent regulation of ERK activity play a key regulatory role in the thrombin signaling pathway
15247770 Prevalent MKP-1 expression in renal cell carcinoma contributes to cancer cell survival by attenuating an apoptosis inducing signal cascade via JNK.
15173070 CL100/MKP-1 has a role in progression of non-small cell lung cancer
15059515 The expression of MKP-1 in gastric cancer cell line was elevated under hypoxia, which could downregulate the hypoxia-inducible factor 1 trans-activition activity thereby repressing the expression of downstream target vascular endothelial growth factor.
14724291 the molecular mechanisms underlying the survival function of NGF in CESS B cell line predominantly consist in maintaining elevated levels of MKP-1 protein, which controls p38 MAPK activation.
14680833 Here we found that hypoxia induces MKP-1 expression in human hepatoma cells HepG2 in a time-dependent manner.
14551204 Jak2 is required for Ang II-induced ERK2 inactivation via induction of MKP-1 gene expression.
12960255 requirement of MAPK phosphatase-1 induction and therefore, inhibition of p38 MAPK in the ANP-mediated inhibition of TNF-alpha-induced expression of MCP-1
12947325 Cardiopulmonary bypass reduces ERK1/2 and p38 activity in peripheral tissue, potentially by MKP-1.
12890671 MKP1 is a transcriptional target of p53 involved in cell cycle regulation
12765304 our data suggest that deletion of the hv3005 and the 3-30.3 genes may predispose individual SLE patients to the development of lupus nephritis
12506119 role of activation on cAMP-dependent protein kinase enhancement of CYP17 transcription
12432554 Expression of MKP-1 may be associated with shorter progression-free survival times
12391149 Data suggest that mitogen-activated protein kinase phosphatase 1 (MKP-1) participates in a negative-feedback loop which regulates p38 function and that dexamethasone may inhibit proinflammatory gene expression in part by inducing MKP-1 expression.
12356755 glucocorticoids synergistically enhance NTHi-induced TLR2 expression via specific up-regulation of the MAPK phosphatase-1 (MKP-1) that, in turn, leads to dephosphorylation and inactivation of p38 MAPK
12080474 CL100 down regulation is associated with advanced stages of epithelial ovarian neoplasms

AA Sequence

MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAE      1 - 70
LRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQS     71 - 140
TPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANC    141 - 210
PNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVK    211 - 280
LDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHST    281 - 350
NSALSYLQSPITTSPSC                                                         351 - 367
//

Text Mined References (166)

PMID Year Title
26769965 2016 Heparin Decreases in Tumor Necrosis Factor ? (TNF?)-induced Endothelial Stress Responses Require Transmembrane Protein 184A and Induction of Dual Specificity Phosphatase 1.
26689986 2015 MKP1 mediates chemosensitizer effects of E1a in response to cisplatin in non-small cell lung carcinoma cells.
26546680 2016 Negative Feed-forward Control of Tumor Necrosis Factor (TNF) by Tristetraprolin (ZFP36) Is Limited by the Mitogen-activated Protein Kinase Phosphatase, Dual-specificity Phosphatase 1 (DUSP1): IMPLICATIONS FOR REGULATION BY GLUCOCORTICOIDS.
26329166 2015 Mitogen-activated protein kinase phosphatase 1 is involved in tamoxifen resistance in MCF7 cells.
26280733 2015 Progesterone and the Repression of Myometrial Inflammation: The Roles of MKP-1 and the AP-1 System.
26176177 2016 Association Between MKP-1, BDNF, and Gonadal Hormones with Depression on Perimenopausal Women.
26158762 2015 MiR-101 targets DUSP1 to regulate the TGF-? secretion in sorafenib inhibits macrophage-induced growth of hepatocarcinoma.
26111828 2015 MKP1 phosphatase mediates G1-specific dephosphorylation of H3Serine10P in response to DNA damage.
25872469 2015 Production of DUSP1 protein using the baculovirus insect cell expression system and its in vitro effects on cancer cells.
25858560 2015 AMPK Suppresses Vascular Inflammation In Vivo by Inhibiting Signal Transducer and Activator of Transcription-1.
25798824 2015 Suppression of dual specificity phosphatase I expression inhibits hepatitis C virus replication.
25724669 2015 Temporal regulation of cytokine mRNA expression by tristetraprolin: dynamic control by p38 MAPK and MKP-1.
25638726 2015 EGR-1 and DUSP-1 are important negative regulators of pro-allergic responses in airway epithelium.
25617504 2015 Disruption of a regulatory loop between DUSP1 and p53 contributes to hepatocellular carcinoma development and progression.
25593344 2015 DUSP1 expression induced by HDAC1 inhibition mediates gefitinib sensitivity in non-small cell lung cancers.
25389768 2014 CYLD negatively regulates nontypeable Haemophilus influenzae-induced IL-8 expression via phosphatase MKP-1-dependent inhibition of ERK.
25377473 2014 Mitochondrial MKP1 is a target for therapy-resistant HER2-positive breast cancer cells.
25370852 2015 MAP kinase phosphatase DUSP1 is overexpressed in obese humans and modulated by physical exercise.
25312268 2014 DUSP1 phosphatase regulates the proinflammatory milieu in head and neck squamous cell carcinoma.
25296132 2015 Inhibitors of Phosphodiesterase 4, but Not Phosphodiesterase 3, Increase ?2-Agonist-Induced Expression of Antiinflammatory Mitogen-Activated Protein Kinase Phosphatase 1 in Airway Smooth Muscle Cells.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25204653 2014 Post-translational regulation of mitogen-activated protein kinase phosphatase (MKP)-1 and MKP-2 in macrophages following lipopolysaccharide stimulation: the role of the C termini of the phosphatases in determining their stability.
25044272 2015 MKP-1 is a target of miR-210 and mediate the negative regulation of miR-210 inhibitor on hypoxic hPASMC proliferation.
24692548 2014 Roles for the mitogen-activated protein kinase (MAPK) phosphatase, DUSP1, in feedback control of inflammatory gene expression and repression by dexamethasone.
24658355 2014 Functional analysis of MKP-1 and MKP-2 in breast cancer tamoxifen sensitivity.
24578378 2014 Mitogen-activated protein kinase phosphatase-1 promotes neovascularization and angiogenic gene expression.
24339725 2013 Analysis of superoxide dismutase 1, dual-specificity phosphatase 1, and transforming growth factor, beta 1 genes expression in keratoconic and non-keratoconic corneas.
24308939 2013 Regulation of angiopoietin-1/Tie-2 receptor signaling in endothelial cells by dual-specificity phosphatases 1, 4, and 5.
24267255 2013 Obstructive sleep apnea and intermittent hypoxia increase expression of dual specificity phosphatase 1.
24155659 2013 DNA methylation profiling revealed promoter hypermethylation-induced silencing of p16, DDAH2 and DUSP1 in primary oral squamous cell carcinoma.
24086554 2013 Febuxostat, an inhibitor of xanthine oxidase, suppresses lipopolysaccharide-induced MCP-1 production via MAPK phosphatase-1-mediated inactivation of JNK.
24080497 2014 Dual specificity phosphatase 1 expression inversely correlates with NF-?B activity and expression in prostate cancer and promotes apoptosis through a p38 MAPK dependent mechanism.
23825193 2013 Mitogen-activated protein kinase phosphatase 1 disrupts proinflammatory protein synthesis in endotoxin-adapted monocytes.
23625220 2013 Pneumolysin-mediated expression of ?-defensin 2 is coordinated by p38 MAP kinase-MKP1 in human airway cells.
23169297 2013 Evidence for downregulation of the negative regulator SPRED2 in clinical prostate cancer.
23149933 2013 Oxidized DJ-1 inhibits p53 by sequestering p53 from promoters in a DNA-binding affinity-dependent manner.
23097457 2013 Kaposi's sarcoma-associated herpesvirus suppression of DUSP1 facilitates cellular pathogenesis following de novo infection.
23030431 2012 Regulation of tristetraprolin expression by mitogen-activated protein kinase phosphatase-1.
22991462 2012 Redox regulation of MAPK phosphatase 1 controls monocyte migration and macrophage recruitment.
22924482 2013 The expression of dual-specificity phosphatase 1 mRNA is downregulated in lesional psoriatic skin.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22743041 2012 Sphingosine 1-phosphate induces MKP-1 expression via p38 MAPK- and CREB-mediated pathways in airway smooth muscle cells.
22610099 2012 Phosphodiesterase 4B mediates extracellular signal-regulated kinase-dependent up-regulation of mucin MUC5AC protein by Streptococcus pneumoniae by inhibiting cAMP-protein kinase A-dependent MKP-1 phosphatase pathway.
22301548 2012 Vitamin D inhibits monocyte/macrophage proinflammatory cytokine production by targeting MAPK phosphatase-1.
22200679 2012 MKP-1: a negative feedback effector that represses MAPK-mediated pro-inflammatory signaling pathways and cytokine secretion in human airway smooth muscle cells.
22020934 2011 Progesterone receptor inhibits proliferation of human breast cancer cells via induction of MAPK phosphatase 1 (MKP-1/DUSP1).
22014408 2012 S-Nitrosylation of mitogen activated protein kinase phosphatase-1 suppresses radiation-induced apoptosis.
21960346 2011 Imbalanced expression of mitogen-activated protein kinase phosphatase-1 and phosphorylated extracellular signal-regulated kinases in lung squamous cell carcinoma.
21959016 2011 Regulation of the p38 mitogen-activated protein kinase and dual-specificity phosphatase 1 feedback loop modulates the induction of interleukin 6 and 8 in cells infected with coronavirus infectious bronchitis virus.
21911040 2011 MAPK phosphatase-1 contributes to trichostatin A inhibition of cyclooxygenase-2 expression in human umbilical vascular endothelial cells exposed to lipopolysaccharide.
21840882 2011 Tauroursodeoxycholate (TUDCA) inhibits neointimal hyperplasia by suppression of ERK via PKC?-mediated MKP-1 induction.
21803700 2011 Involvement of MAPK phosphatase-1 in dexamethasone-induced chemoresistance in lung cancer.
21733716 2011 MKP-1 regulates cytokine mRNA stability through selectively modulation subcellular translocation of AUF1.
21715333 2011 T-LAK cell-originated protein kinase (TOPK) phosphorylation of MKP1 protein prevents solar ultraviolet light-induced inflammation through inhibition of the p38 protein signaling pathway.
21610072 2011 Signal integration and coincidence detection in the mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) cascade: concomitant activation of receptor tyrosine kinases and of LRP-1 leads to sustained ERK phosphorylation via down-regulation of dual specificity phosphatases (DUSP1 and -6).
21547253 2011 Dual specificity phosphatase 1 regulates human inducible nitric oxide synthase expression by p38 MAP kinase.
21507959 2011 Casein kinase 2 regulates the mRNA-destabilizing activity of tristetraprolin.
21454676 2011 Down-regulation of cytokine-induced interleukin-8 requires inhibition of p38 mitogen-activated protein kinase (MAPK) via MAPK phosphatase 1-dependent and -independent mechanisms.
21060794 2010 Transcriptional regulation of human dual specificity protein phosphatase 1 (DUSP1) gene by glucocorticoids.
20953200 2010 A negative regulator of MAP kinase causes depressive behavior.
20936779 2010 A human MAP kinase interactome.
20890299 2011 DUSP1/MKP1 promotes angiogenesis, invasion and metastasis in non-small-cell lung cancer.
20868379 2010 MKP1 regulates the induction of inflammatory response by pneumococcal pneumolysin in human epithelial cells.
20829434 2010 Identification of NURR1 as a mediator of MIF signaling during chronic arthritis: effects on glucocorticoid-induced MKP1.
20805296 2011 Genetic variants within the MAP kinase signalling network and anti-TNF treatment response in rheumatoid arthritis patients.
20803086 2010 MKP1 regulates the induction of MCP1 by Streptococcus pneumoniae pneumolysin in human epithelial cells.
20708668 2010 Impact of DUSP1 on the apoptotic potential of deoxynivalenol in the epithelial cell line HepG2.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20673984 2010 Dual-specificity phosphatase 1 as a pharmacogenetic modifier of inhaled steroid response among asthmatic patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20555314 2010 NF-kappaB-mediated expression of MAPK phosphatase-1 is an early step in desensitization to TLR ligands in enterocytes.
20375469 2010 MAP kinase phosphatase-1--a new player at the nexus between sarcopenia and metabolic disease.
20353815 2010 Investigation of low-dose ritonavir on human peripheral blood mononuclear cells using gene expression whole genome microarrays.
20347885 2010 DUSP26 negatively affects the proliferation of epithelial cells, an effect not mediated by dephosphorylation of MAPKs.
20228065 2010 Oxidative modification of nuclear mitogen-activated protein kinase phosphatase 1 is involved in transforming growth factor beta1-induced expression of plasminogen activator inhibitor 1 in fibroblasts.
20145951 2010 Induction of MKP-1 prevents the cytotoxic effects of PI3K inhibition in hilar cholangiocarcinoma cells.
20100830 2010 Endotoxin conditioning induces VCP/p97-mediated and inducible nitric-oxide synthase-dependent Tyr284 nitration in protein phosphatase 2A.
20089808 2010 Mitogen-activated protein kinase phosphatase-1 negatively regulates the expression of interleukin-6, interleukin-8, and cyclooxygenase-2 in A549 human lung epithelial cells.
20043958 2010 Proteasomal inhibition upregulates the endogenous MAPK deactivator MKP-1 in human airway smooth muscle: mechanism of action and effect on cytokine secretion.
19940143 2010 Glucocorticoid regulation of mouse and human dual specificity phosphatase 1 (DUSP1) genes: unusual cis-acting elements and unexpected evolutionary divergence.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19892016 2010 Distinct roles for mitogen-activated protein kinase phosphatase-1 (MKP-1) and ERK-MAPK in PTH1R signaling during osteoblast proliferation and differentiation.
19797979 2010 Angiotensin II signaling via type 2 receptors in a human model of vascular hyporeactivity: implications for hypertension.
19793766 2010 Induction of MAPK phosphatase-1 by hypothermia inhibits TNF-alpha-induced endothelial barrier dysfunction and apoptosis.
19755862 2009 Involvement of MKP-1 and Bcl-2 in acquired cisplatin resistance in ovarian cancer cells.
19724859 2009 Gene expression profile of residual breast cancer after doxorubicin and cyclophosphamide neoadjuvant chemotherapy.
19697705 2009 [The expression of MKP-1 and p-ERK(1/2) in primary ovarian epithelial tumor tissues].
19648110 2009 Inhibition of NF-kappaB-dependent transcription by MKP-1: transcriptional repression by glucocorticoids occurring via p38 MAPK.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19553005 2009 MKP1 repression is required for the chemosensitizing effects of NF-kappaB and PI3K inhibitors to cisplatin in non-small cell lung cancer.
19417026 2009 Mitogen-activated protein kinase phosphatase-1 in human breast cancer independently predicts prognosis and is repressed by doxorubicin.
19411256 2009 KLF5 promotes breast cell survival partially through fibroblast growth factor-binding protein 1-pERK-mediated dual specificity MKP-1 protein phosphorylation and stabilization.
19262425 2009 Investigation of genetic variants within candidate genes of the TNFRSF1B signalling pathway on the response to anti-TNF agents in a UK cohort of rheumatoid arthritis patients.
19032224 2008 The MAP kinase phosphatase-1 MKP-1/DUSP1 is a regulator of human liver response to transplantation.
19020052 2009 Histone H3 as a novel substrate for MAP kinase phosphatase-1.
18782768 2008 MKP1 regulates the induction of MUC5AC mucin by Streptococcus pneumoniae pneumolysin by inhibiting the PAK4-JNK signaling pathway.
18726921 2008 High level of mitogen-activated protein kinase phosphatase-1 expression is associated with cisplatin resistance in osteosarcoma.
18723442 2008 Increased endothelial mitogen-activated protein kinase phosphatase-1 expression suppresses proinflammatory activation at sites that are resistant to atherosclerosis.
18519678 2008 Dual-specificity phosphatase 1 ubiquitination in extracellular signal-regulated kinase-mediated control of growth in human hepatocellular carcinoma.
18490444 2008 MKP-1 mRNA stabilization and translational control by RNA-binding proteins HuR and NF90.
18477563 2008 Phosphorylated heat shock protein 27 represses growth of hepatocellular carcinoma via inhibition of extracellular signal-regulated kinase.
18441094 2008 Glucocorticoid regulation of CD38 expression in human airway smooth muscle cells: role of dual specificity phosphatase 1.
18434324 2008 Phosphorylation of protein kinase Cdelta on distinct tyrosine residues induces sustained activation of Erk1/2 via down-regulation of MKP-1: role in the apoptotic effect of etoposide.
18403641 2008 DUSP1 is controlled by p53 during the cellular response to oxidative stress.
18367666 2008 MKP-1 inhibits high NaCl-induced activation of p38 but does not inhibit the activation of TonEBP/OREBP: opposite roles of p38alpha and p38delta.
18314542 2008 Corticosteroids reduce IL-6 in ASM cells via up-regulation of MKP-1.
18178562 2008 Epidermal growth factor receptor and protein kinase C signaling to ERK2: spatiotemporal regulation of ERK2 by dual specificity phosphatases.
18095520 2007 Modulation of the p38MAPK pathway in failing human myocardium secondary to rheumatic heart disease.
18089824 2007 ERK-dependent MKP-1-mediated cisplatin resistance in human ovarian cancer cells.
18003751 2008 VEGF and thrombin induce MKP-1 through distinct signaling pathways: role for MKP-1 in endothelial cell migration.
17848570 2007 Role of MAPK phosphatase-1 in sustained activation of JNK during ethanol-induced apoptosis in hepatocyte-like VL-17A cells.
17761948 2007 Mitogen-activated protein kinase phosphatase 1/dual specificity phosphatase 1 mediates glucocorticoid inhibition of osteoblast proliferation.
17690186 2007 c-Jun NH2 terminal kinase activation and decreased expression of mitogen-activated protein kinase phosphatase-1 play important roles in invasion and angiogenesis of urothelial carcinomas.
17681939 2007 Several dual specificity phosphatases coordinate to control the magnitude and duration of JNK activation in signaling response to oxidative stress.
17638884 2007 Dual specificity phosphatase 1/CL100 is a direct transcriptional target of E2F-1 in the apoptotic response to oxidative stress.
17489738 2007 Connective tissue growth factor (CTGF) promotes activated mesangial cell survival via up-regulation of mitogen-activated protein kinase phosphatase-1 (MKP-1).
17131384 2007 ERK1/2-driven and MKP-mediated inhibition of EGF-induced ERK5 signaling in human proximal tubular cells.
17073741 2006 Dual-specificity phosphatase 1: a critical regulator of innate immune responses.
16951204 2006 Mitogen-activated protein kinase phosphatase-1 is required for cisplatin resistance.
16387640 2006 The endocannabinoid anandamide protects neurons during CNS inflammation by induction of MKP-1 in microglial cells.
16293973 2005 Suppressed MKP-1 is an independent predictor of outcome in patients with hepatocellular carcinoma.
16289033 2005 MKP-1 contributes to oxidative stress-induced apoptosis via inactivation of ERK1/2 in SH-SY5Y cells.
16286470 2006 Cooperation of ERK and SCFSkp2 for MKP-1 destruction provides a positive feedback regulation of proliferating signaling.
16224818 2005 Macrophage migration inhibitory factor promotes innate immune responses by suppressing glucocorticoid-induced expression of mitogen-activated protein kinase phosphatase-1.
16081065 2005 Dual-specificity phosphatase DUSP1 protects overactivation of hypoxia-inducible factor 1 through inactivating ERK MAPK.
16044158 2005 DNA damage in transcribed genes induces apoptosis via the JNK pathway and the JNK-phosphatase MKP-1.
15677475 2005 Preheating accelerates mitogen-activated protein (MAP) kinase inactivation post-heat shock via a heat shock protein 70-mediated increase in phosphorylated MAP kinase phosphatase-1.
15614136 2005 Contribution of MKP-1 regulation of p38 to endotoxin tolerance.
15590693 2005 Glucocorticoid receptor-induced MAPK phosphatase-1 (MPK-1) expression inhibits paclitaxel-associated MAPK activation and contributes to breast cancer cell survival.
15569826 2005 Atrial natriuretic peptide induces mitogen-activated protein kinase phosphatase-1 in human endothelial cells via Rac1 and NAD(P)H oxidase/Nox2-activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15448190 2004 Evidence that mitogen-activated protein kinase phosphatase-1 induction by proteasome inhibitors plays an antiapoptotic role.
15339908 2004 Role of CL-100, a dual specificity phosphatase, in thrombin-induced endothelial cell activation.
15247770 2004 Inhibition of MKP-1 expression potentiates JNK related apoptosis in renal cancer cells.
15173070 2004 Mitogen-activated protein kinase phosphatase-1 is overexpressed in non-small cell lung cancer and is an independent predictor of outcome in patients.
15059515 2004 [The overexpression and significance of MKP-1 in oxygen-deprived gastric cancer cell line SGC7901].
14724291 2004 Nerve growth factor-dependent survival of CESS B cell line is mediated by increased expression and decreased degradation of MAPK phosphatase 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14680833 2003 Suppression of the dual-specificity phosphatase MKP-1 enhances HIF-1 trans-activation and increases expression of EPO.
14551204 2004 Jak2 tyrosine kinase mediates angiotensin II-dependent inactivation of ERK2 via induction of mitogen-activated protein kinase phosphatase 1.
12960255 2003 ANP inhibits TNF-alpha-induced endothelial MCP-1 expression--involvement of p38 MAPK and MKP-1.
12947325 2003 Cardiopulmonary bypass reduces peripheral microvascular contractile function by inhibition of mitogen-activated protein kinase activity.
12890671 2003 The phosphatase MKP1 is a transcriptional target of p53 involved in cell cycle regulation.
12765304 2003 Association of homozygous deletion of the Humhv3005 and the VH3-30.3 genes with renal involvement in systemic lupus erythematosus.
12506119 2003 CAMP-dependent protein kinase enhances CYP17 transcription via MKP-1 activation in H295R human adrenocortical cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432554 2002 Expression of mitogen-activated protein kinase phosphatase-1 (MKP-1) in primary human ovarian carcinoma.
12391149 2002 Dexamethasone causes sustained expression of mitogen-activated protein kinase (MAPK) phosphatase 1 and phosphatase-mediated inhibition of MAPK p38.
12356755 2002 Inhibition of p38 MAPK by glucocorticoids via induction of MAPK phosphatase-1 enhances nontypeable Haemophilus influenzae-induced expression of toll-like receptor 2.
11278799 2001 Distinct binding determinants for ERK2/p38alpha and JNK map kinases mediate catalytic activation and substrate selectivity of map kinase phosphatase-1.
11062068 2000 Catalytic activation of mitogen-activated protein (MAP) kinase phosphatase-1 by binding to p38 MAP kinase: critical role of the p38 C-terminal domain in its negative regulation.
10617468 1999 Reduced MAP kinase phosphatase-1 degradation after p42/p44MAPK-dependent phosphorylation.
9828130 1998 Cloning of ARE-containing genes by AU-motif-directed display.
9599409 1998 Protein phosphatases and the regulation of MAP kinase activity.
9571625 1998 The "VH1-like" dual-specificity protein tyrosine phosphatases.
8626452 1996 The mitogen-activated protein kinase phosphatases PAC1, MKP-1, and MKP-2 have unique substrate specificities and reduced activity in vivo toward the ERK2 sevenmaker mutation.
8390041 1993 The human CL100 gene encodes a Tyr/Thr-protein phosphatase which potently and specifically inactivates MAP kinase and suppresses its activation by oncogenic ras in Xenopus oocyte extracts.
8389479 1993 The growth factor-inducible immediate-early gene 3CH134 encodes a protein-tyrosine-phosphatase.
8221888 1993 MKP-1 (3CH134), an immediate early gene product, is a dual specificity phosphatase that dephosphorylates MAP kinase in vivo.
8168826 1994 The CL100 gene, which encodes a dual specificity (Tyr/Thr) MAP kinase phosphatase, is highly conserved and maps to human chromosome 5q34.
8106404 1994 Isolation and characterization of a human dual specificity protein-tyrosine phosphatase gene.
7806236 1994 Chromosomal localization of four human VH1-like protein-tyrosine phosphatases.
7593328 1995 XCL100, an inducible nuclear MAP kinase phosphatase from Xenopus laevis: its role in MAP kinase inactivation in differentiated cells and its expression during early development.
7535770 1995 Pro-inflammatory cytokines and environmental stress cause p38 mitogen-activated protein kinase activation by dual phosphorylation on tyrosine and threonine.
1406996 1992 Oxidative stress and heat shock induce a human gene encoding a protein-tyrosine phosphatase.