Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.17
PubTator Score 5.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
colon cancer 1.300 1.7e-02
group 3 medulloblastoma 1.200 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.7e-02
malignant mesothelioma 2.100 6.5e-08
non-small cell lung cancer 1.301 5.5e-17
osteosarcoma -1.071 1.4e-03
pituitary cancer 1.100 1.7e-07
posterior fossa group B ependymoma 1.100 3.4e-06
psoriasis -1.100 2.2e-03

Gene RIF (2)

AA Sequence

MKSDCMQTTICQERKKDPIEMFHSGQLVKVCAPMVRYSKLAFRTLVRKYSCDLCYTPMIVAADFVKSIKA      1 - 70
RDSEFTTNQGDCPLIVQFAANDARLLSDAARIVCPYANGIDINCGCPQRWAMAEGYGACLINKPELVQDM     71 - 140
VKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMS    141 - 210
IPVIANGDIRSLKEAENVWRITGTDGVMVARGLLANPAMFAGYEETPLKCIWDWVDIALELGTPYMCFHQ    211 - 280
HLMYMMEKITSRQEKRVFNALSSTSAIIDYLTDHYGI                                     281 - 317
//

Text Mined References (8)

PMID Year Title