Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.73
PubTator Score 11.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.3e-04
psoriasis 6685 1.0e-03
lung cancer 4473 3.8e-02
Disease Target Count Z-score Confidence
Kabuki syndrome 29 3.321 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 1.0e-03
osteosarcoma -1.009 1.3e-04
lung cancer 1.100 3.8e-02

Gene RIF (5)

PMID Text
26429968 This is the first reported case of a tRNA-modifying enzyme (dihydrouridine synthase 2) carrying a dsRNA binding domain used to bind tRNAs.
26143927 Here, the X-ray crystal structure of a construct of hDus2 encompassing the catalytic and tRNA-recognition domains (residues 1-340) determined at 1.9 A resolution is presented.
22442237 crystals belonged to space group P2(1) and contained a single molecule of HsDus2L in the asymmetric unit
20877624 Observational study of gene-disease association. (HuGE Navigator)
18096616 hDUS2 interacts with protein kinase PKR through its dsRNA binding/dimerization domain and inhibits its kinase activity.

AA Sequence

MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDD      1 - 70
RVVFRTCEREQNRVVFQMGTSDAERALAVARLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKI     71 - 140
LSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIP    141 - 210
VIANGGSHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTN    211 - 280
TKYCLCQMLREQLESPQGRLLHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTS    281 - 350
GVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKK    351 - 420
LAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPL    421 - 490
EGW                                                                       491 - 493
//

Text Mined References (19)

PMID Year Title
26429968 2015 An extended dsRBD is required for post-transcriptional modification in human tRNAs.
26143927 2015 From bacterial to human dihydrouridine synthase: automated structure determination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22741570 2012 Molecular evolution of dihydrouridine synthases.
22442237 2012 Crystallization and preliminary X-ray crystallographic analysis of the catalytic domain of human dihydrouridine synthase.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18425323 2008 Characterization of gene expression regulated by American ginseng and ginsenoside Rg3 in human colorectal cancer cells.
18096616 2008 Interaction of human tRNA-dihydrouridine synthase-2 with interferon-induced protein kinase PKR.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15994936 2005 A novel human tRNA-dihydrouridine synthase involved in pulmonary carcinogenesis.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.