Property Summary

NCBI Gene PubMed Count 19
PubMed Score 45.52
PubTator Score 30.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Hypothyroidism 89 3.668 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.112 2.5e-06
Atopic dermatitis 1.500 6.6e-05
non-small cell lung cancer -1.406 5.2e-17
interstitial cystitis -2.900 6.8e-06
psoriasis 1.400 4.1e-14
lung adenocarcinoma -2.800 2.8e-11
Endometriosis -1.675 4.7e-02
lung carcinoma -1.800 3.1e-30
spina bifida -1.062 3.2e-02
gastric carcinoma -1.700 8.7e-03

Gene RIF (2)

PMID Text
19339556 Heterodimerization controls localization of Duox-DuoxA NADPH oxidases in airway cells.
19322654 DUOXA1 transient overexpression affected the cell-cell adhesion by modulating the actin cytoskeleton

AA Sequence

MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAV      1 - 70
NFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNETINYNEEFTWRLGENYAE     71 - 140
EYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYML    141 - 210
LATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLK    211 - 280
AFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL           281 - 343
//

Text Mined References (19)

PMID Year Title
23033809 2013 Sexual dimorphism of thyroid reactive oxygen species production due to higher NADPH oxidase 4 expression in female thyroid glands.
23010498 2013 Thyroid hydrogen peroxide production is enhanced by the Th2 cytokines, IL-4 and IL-13, through increased expression of the dual oxidase 2 and its maturation factor DUOXA2.
22874065 2012 Regulation of dual oxidase expression and H2O2 production by thyroglobulin.
22814254 2012 The type of DUOX-dependent ROS production is dictated by defined sequences in DUOXA.
21367925 2011 A single copy of the recently identified dual oxidase maturation factor (DUOXA) 1 gene produces only mild transient hypothyroidism in a patient with a novel biallelic DUOXA2 mutation and monoallelic DUOXA1 deletion.
21362455 2011 p53-mediated regulation of neuronal differentiation via regulation of dual oxidase maturation factor 1.
20826581 2010 Functional consequences of dual oxidase-thyroperoxidase interaction at the plasma membrane.
20407074 2010 Dual oxidase, hydrogen peroxide and thyroid diseases.
20122987 2010 Defects of thyroidal hydrogen peroxide generation in congenital hypothyroidism.
20060878 2010 Delimitation and functional characterization of the bidirectional THOX-DUOXA promoter regions in thyrocytes.
19339556 2009 Heterodimerization controls localization of Duox-DuoxA NADPH oxidases in airway cells.
19322654 2010 NIP1/DUOXA1 expression in epithelial breast cancer cells: regulation of cell adhesion and actin dynamics.
19074510 2009 Duox maturation factors form cell surface complexes with Duox affecting the specificity of reactive oxygen species generation.
16651268 2006 Identification of the maturation factor for dual oxidase. Evolution of an eukaryotic operon equivalent.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670962 2004 A novel transmembrane protein recruits numb to the plasma membrane during asymmetric cell division.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.