Property Summary

NCBI Gene PubMed Count 83
PubMed Score 226.99
PubTator Score 153.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
urothelial carcinoma -3.100 6.7e-03
uncontrolled asthma -1.600 3.8e-02
primary pancreatic ductal adenocarcinoma 2.345 4.9e-02
intraductal papillary-mucinous neoplasm ... 2.800 4.1e-02
active Crohn's disease 6.952 3.2e-06
active ulcerative colitis 8.509 3.2e-05
pancreatic cancer 2.800 3.0e-04
interstitial cystitis -2.700 4.9e-03
nasopharyngeal carcinoma -1.500 4.8e-03

Gene RIF (68)

PMID Text
27349010 inactivating mutations in the DUOXA2 (p.Y246X) and DUOX2 (p.R885Q) genes were identified in a set of dizygotic twins with congenital hypothyroidism
26823467 Decreased Panx1 function is a response to cell acidification mediated by IFN-gamma-induced up-regulation of Duox2.
26742565 The prognosis of Japanese patients with DUOX2 defects was usually transient Congenital hypothyroidism. Delayed improvement of thyroglobulin indicates that these patients have subclinical hypothyroidism.
26506010 Results identified 2 mutations in DUOX2 gene from patient with congenital hypothyroidism and report new cryptic splicing sites in the intron 17 and exon 18.
26349762 Prevalence of DUOX2 pathogenic variants is 29% among patients with congenital hypothyroidism in Guangxi, China. Monoallelic and biallelic DUOX2 variants are associated with transient, while triallelic variants are associated with permanent disease.
26261005 Mucosal dysbiosis leads to increased expression of DUOX2, which might be a marker of perturbed mucosal homeostasis in patients with early-stage inflammatory bowel disease.
26207686 Taken together these data suggest that chemopotentiation by LDFRT in gastric cancer cells may be due, at least in part, to increased ROS production (DUOX2) without upregulation of the DNA repair machinery
26056003 findings demonstrate that PKCalpha plays a critical role in HCC development by inducing DUOX2 expression and ROS generation, and propose a strategy to target PKCalpha/DUOX2 as a potential adjuvant therapy for HCC treatment
26046128 DUOX2 played an important role in innate immunity against Klebsiella pneumoniae cytoinvasion through the reactive oxygen species pathway in T24 cells.
25761904 The folding of DUOX2 appears to be a key event in the trafficking of the DUOX2/DUOXA2 complex as it promotes an appropriate conformation of the N-terminal region, which is propitious to subsequent covalent interactions with the maturation factor, DUOXA2.
25616291 Heterozygous mutations in DUOX2 may affect protein function and cause congenital hypothyroidism.
25586178 Duox2 proteins possessing the A-loops of Nox1 or Nox5 co-expressed with DuoxA2 showed enhanced O2 () release, and Duox1 proteins possessing the A-loops of Nox1 or Nox5 co-expressed with DuoxA1 acquired O2 () leakage
25263060 Data indicate dual oxidase 2 protein (DUOX2) mutation-carrying pedigree presenting pseudodominant inheritance of nonautoimmune hypothyroidism.
25248169 DUOX2 variants are a relatively common cause of congenital hypothyroidism with normal-sized or enlarged eutopic thyroid
25003194 An increase of DUOX2 expression was seen in association with an expansion of Proteobacteria in both ulcerative colitis and Crohn disease, while expression of APOA1 gene was downregulated and associated with Crohn disease-specific alterations in Firmicutes
24735383 Genotypes and phenotypes of congenital goitre and hypothyroidism caused by mutations in dual oxidase 2 genes.
24492313 DUOX2 is Significantly Upregulated in Active Ulcerative Colitis and during Progression to Dysplasia.
24423310 The most robust clinical parameters for selecting patients for DUOX2 analysis have been identified, and several DUOX2 variants have been functionally characterized.
24164541 Underscore the importance of DUOX1 and DUOX2 in vesicant-induced IL-6 secretion in human airway epithelial cells.
24161126 Despite the high sequence similarity shared between DUOX1 and DUOX2, the two isoforms present distinct regulations, tissue expression and catalytic functions
24128054 Further, ROS generated by Duox enzymes localized adjacent to nuclear speckles altered the splicing of viral genes
24127536 family showed potential linkage to DUOX2 locus and we detected a nonsense mutation (R434X) in both cases and the mutation segregated with disease status in the family
23728617 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3
23545780 A key function of DUOX2 in the establishment of a late antiviral state triggered by the synergistic autocrine/paracrine action of IFNbeta and TNFalpha secreted during respiratory virus infection.
23457309 p.G488R missense mutation in the DUOX2 gene of the congenital hypothyroidism patients is associated with thyroid dysfunction that presents during the neonatal period.
23404210 Duox2 was expressed at elevated levels in many human cancers, most notably tumors of the prostate, lung, colon and breast.
23362256 Study indicates a complex profile of protein interactions required for activity and localization of the DUOX1 and DOOX2 enzymes.
23296709 The dramatic increase in reactive oxygen species induced in pancreatic cancer cells by the combination of lipopolysaccharide and interferon-gamma depends critically on the upregulation of, and signaling through, the Toll-like receptor (TLR)4 pathway.
23281318 upregulated in chronic rhinosinusitis as a part of inflammatory response
23225414 Report shows that ROS levels in PC3 cells are constitutively maintained by DUOX 1 and 2 enzymes, and these ROS positively regulate AKT signalling through inactivating phosphatases, leading to increased resistance to apoptosis.
23010498 The present data open new perspectives for a better understanding of the pathophysiology of thyroid autoimmune diseases considering DUOX2-mediated oxidative damages.
22814254 alterations of the DUOXA2 NH(2)-terminal domain modify DUOX2 activity triggering superoxide leaking
22592922 Two functionally important single-nucleotide polymorphisms within the promoter differentially regulate DUOX2/DUOXA2 transcription in response to exogenous double-stranded DNA.
22523549 study reports DUOX 1 and 2 are expressed in neuroblastoma SK-N-BE cells as well as in an oligodendrocyte cell line (MO3-13); data unravel a novel mechanism of regulation of DUOX enzymes by reactive oxygen species and identify a circuitry linking NADPH oxidase activity to DUOX1 and 2 levels in neuroblastoma cells
22336364 p.Arg376Trp mutation in DUOX2 was found in newborns of congenital hypothyroidism.
21915726 Data show that comparing with adjacent non-neoplastic tissues, DUOX1, DUOX2, and NOX4 were expressed at higher frequencies in tumor specimens.
21714724 DUOX2 plays pivotal roles in TLR5-dependent inflammatory response of nasal airway epithelium.
21704604 As was shown for DUOX1, the truncated DUOX2 domain purifies without a bound heme co-factor and displays no peroxidase activity. However, DUOX2(1-599) displays greater stability than DUOX1(1-593).
21565790 Two new mutations (Y1150C and A728T) and the deletion S965FsX994 were responsible for the deficit in the organification process and the phenotypes and three polymorphisms (H678R, P982A, and R701Q) were identified.
21321110 Up-regulation and sustained activation of Stat1 are essential for interferon-gamma (IFN-gamma)-induced dual oxidase 2 (Duox2) and dual oxidase A2 (DuoxA2) expression in human pancreatic cancer cell lines.
21148036 Duox2-mediated signaling via reactive oxygen species participates in polyinosinic-polycytidylic acid-mediated type 1 tumor necrosis factor receptor (TNFR1) shedding downstream of receptor-interacting protein 1 (RIP1) airway epithelial cells (NCI-H292).
20826581 Thyroid peroxidase consumes hydrogen peroxide produced by DUOX2, decreasing the availability of this substance at the apical membrane of thyrocytes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20531308 DUOX2 regulates cell cycle entry via a p53-dependent pathway.
20511343 for respiratory epithelial cells, all-trans retinoic acid is important in the regulation of DUOX2 expression, function, and rhinovirus-mediated DUOX2 inducibility.
20381453 IFNgamma-mediated DUOX2 expression was regulated by a STAT-independent, JAK-independent pathway.
20346360 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19952225 TPO binds to dualoxidases;defects in this association could impair thyroid hormone synthesis and lead to thyroid insufficiency and cell damage.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19789206 Two new mutations in DUOX2 gene responsible for the partial deficit in the organification process of the thyroid gland are identified.
19759286 DUOX2 and NOD2 cooperatively facilitate antibacterial action.
19339556 Heterodimerization controls localization of Duox-DuoxA NADPH oxidases in airway cells.
19144650 Activation of dual oxidases Duox1 and Duox2: differential regulation mediated by camp-dependent protein kinase and protein kinase C-dependent phosphorylation.
18765513 Loss of DUOX2 activity results in transient congenital hypothyroidism and transient congenital hypothyroidism caused by DUOX2 mutations is inherited as an autosomal recessive trait.
18281478 Results suggest that an area on chromosome 15 that includes DUOX1, DUOX2, and their maturation factors is a frequent target for epigenetic silencing in lung cancer.
18177232 Results imply that the airway expression of Duox2 is diversely associated with smoking and chronic obstructive pulmonary disease.
17684392 Analysis of point mutations opens possibility to ascertain whether transiency or permanency of DUOX2 phenotypes relate to monoallelic or biallelic inactivation of gene, or if degree of pathogenic severity of mutations may also influence outcome. (Review)
17374849 DUOXA2 allows rapid ER exit of folded DUOX2 or enhanced degradation of mutant DUOX2 proteins not competent for ER exit.
16651268 co-expression with DUOXA2, an ER-resident transmembrane protein, allows ER-to-Golgi transition, maturation, and translocation to the plasma membrane of functional DUOX2 in a heterologous system
16608528 Observational study of gene-disease association. (HuGE Navigator)
16478776 In conclusion, incubation of normal or GD thyrocytes with Th1 cytokines induces a significant reduction in TSH-increased expression of both TPO and ThOXs, an effect partially mediated by NO.
16322276 Heterozygous mutations in the DUOX2 gene are responsible for iodide organification defect and congenital hypothyroidism.
16111680 Results demonstrate the regulation of Duox1 and 2 expression by Th1 and Th2 cytokines, and suggest a mechanism by which ROS production can be regulated in the respiratory tract as part of the host defense response.
15972824 post-translational modifications during the maturation process of Duox2 could be implicated in the mechanism of H2O2 formation by favoring intramolecular superoxide dismutation
15677770 These data suggest that Duox1 and 2 are the major NADPH oxidases expressed in airway epithelia and therefore contributors of hydrogen peroxide production in the airway lumen.
15591162 Expression of dual oxidase 2 in human colon and Caco-2 cells.
15150274 the dual oxidase 2 N-terminal region is targeted to the plasma membrane

AA Sequence

MLRARPEALMLLGALLTGSLGPSGNQDALSLPWEVQRYDGWFNNLRHHERGAVGCRLQRRVPANYADGVY      1 - 70
QALEEPQLPNPRRLSNAATRGIAGLPSLHNRTVLGVFFGYHVLSDVVSVETPGCPAEFLNIRIPPGDPVF     71 - 140
DPDQRGDVVLPFQRSRWDPETGRSPSNPRDLANQVTGWLDGSAIYGSSHSWSDALRSFSGGQLASGPDPA    141 - 210
FPRDSQNPLLMWAAPDPATGQNGPRGLYAFGAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEE    211 - 280
LFQHARKRVIATYQNIAVYEWLPSFLQKTLPEYTGYRPFLDPSISPEFVVASEQFFSTMVPPGVYMRNAS    281 - 350
CHFRKVLNKGFQSSQALRVCNNYWIRENPNLNSTQEVNELLLGMASQISELEDNIVVEDLRDYWPGPGKF    351 - 420
SRTDYVASSIQRGRDMGLPSYSQALLAFGLDIPRNWSDLNPNVDPQVLEATAALYNQDLSQLELLLGGLL    421 - 490
ESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSKKEIEDIRNTTLRDVLVAVINIDPSALQPNVF    491 - 560
VWHKGAPCPQPKQLTTDGLPQCAPLTVLDFFEGSSPGFAITIIALCCLPLVSLLLSGVVAYFRGREHKKL    561 - 630
QKKLKESVKKEAAKDGVPAMEWPGPKERSSPIIIQLLSDRCLQVLNRHLTVLRVVQLQPLQQVNLILSNN    631 - 700
RGCRTLLLKIPKEYDLVLLFSSEEERGAFVQQLWDFCVRWALGLHVAEMSEKELFRKAVTKQQRERILEI    701 - 770
FFRHLFAQVLDINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLS    771 - 840
FREFLDILVVFMKGSPEDKSRLMFTMYDLDENGFLSKDEFFTMMRSFIEISNNCLSKAQLAEVVESMFRE    841 - 910
SGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGGGGGGNGIRDIFKQNISCRVSFITRTPGERSHPQGL    911 - 980
GPPAPEAPELGGPGLKKRFGKKAAVPTPRLYTEALQEKMQRGFLAQKLQQYKRFVENYRRHIVCVAIFSA    981 - 1050
ICVGVFADRAYYYGFASPPSDIAQTTLVGIILSRGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPF   1051 - 1120
DAAVDFHRWIAMAAVVLAILHSAGHAVNVYIFSVSPLSLLACIFPNVFVNDGSKLPQKFYWWFFQTVPGM   1121 - 1190
TGVLLLLVLAIMYVFASHHFRRRSFRGFWLTHHLYILLYALLIIHGSYALIQLPTFHIYFLVPAIIYGGD   1191 - 1260
KLVSLSRKKVEISVVKAELLPSGVTYLQFQRPQGFEYKSGQWVRIACLALGTTEYHPFTLTSAPHEDTLS   1261 - 1330
LHIRAVGPWTTRLREIYSSPKGNGCAGYPKLYLDGPFGEGHQEWHKFEVSVLVGGGIGVTPFASILKDLV   1331 - 1400
FKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIQEVEENDHQDLVSVHIYVTQLAEKFDLRTTMLYICER   1401 - 1470
HFQKVLNRSLFTGLRSITHFGRPPFEPFFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLVNRQDRAH   1471 - 1540
FMHHYENF                                                                 1541 - 1548
//

Text Mined References (86)

PMID Year Title
27349010 2016 Heterozygous Mutations of the DUOXA2 and DUOX2 Genes in Dizygotic Twins with Congenital Hypothyroidism.
26823467 2016 Dual Oxidase 2 (Duox2) Regulates Pannexin 1-mediated ATP Release in Primary Human Airway Epithelial Cells via Changes in Intracellular pH and Not H2O2 Production.
26742565 2016 Natural course of congenital hypothyroidism by dual oxidase 2 mutations from the neonatal period through puberty.
26506010 2016 Compound heterozygous DUOX2 gene mutations (c.2335-1G>C/c.3264_3267delCAGC) associated with congenital hypothyroidism. Characterization of complex cryptic splice sites by minigene analysis.
26349762 2015 Mutation screening of DUOX2 in Chinese patients with congenital hypothyroidism.
26301257 2015 Defects in NADPH Oxidase Genes NOX1 and DUOX2 in Very Early Onset Inflammatory Bowel Disease.
26261005 2015 Increased Expression of DUOX2 Is an Epithelial Response to Mucosal Dysbiosis Required for Immune Homeostasis in Mouse Intestine.
26207686 2015 Contribution of Dual Oxidase 2 (DUOX2) to Hyper-Radiosensitivity in Human Gastric Cancer Cells.
26056003 2015 PKC? promotes generation of reactive oxygen species via DUOX2 in hepatocellular carcinoma.
26046128 2015 DUOX2 promotes the elimination of the Klebsiella pneumoniae strain K5 from T24 cells through the reactive oxygen species pathway.
25761904 2015 When an Intramolecular Disulfide Bridge Governs the Interaction of DUOX2 with Its Partner DUOXA2.
25616291 2015 [DUOX2 mutations in children with congenital hypothyroidism].
25586178 2015 The extracellular A-loop of dual oxidases affects the specificity of reactive oxygen species release.
25263060 2015 Pseudodominant inheritance in a family with nonautoimmune hypothyroidism due to biallelic DUOX2 mutations.
25248169 2014 High frequency of DUOX2 mutations in transient or permanent congenital hypothyroidism with eutopic thyroid glands.
25003194 2014 Pediatric Crohn disease patients exhibit specific ileal transcriptome and microbiome signature.
24735383 2014 Genotypes and phenotypes of congenital goitre and hypothyroidism caused by mutations in dual oxidase 2 genes.
24492313 2014 DUOX2 and DUOXA2 form the predominant enzyme system capable of producing the reactive oxygen species H2O2 in active ulcerative colitis and are modulated by 5-aminosalicylic acid.
24423310 2014 The clinical and molecular characterization of patients with dyshormonogenic congenital hypothyroidism reveals specific diagnostic clues for DUOX2 defects.
24164541 2014 Role of nicotinamide adenine dinucleotide phosphate oxidase in mediating vesicant-induced interleukin-6 secretion in human airway epithelial cells.
24161126 2014 Roles of DUOX-mediated hydrogen peroxide in metabolism, host defense, and signaling.
24128054 2014 Mucosal reactive oxygen species are required for antiviral response: role of Duox in influenza a virus infection.
24127536 2014 A truncating DUOX2 mutation (R434X) causes severe congenital hypothyroidism.
23545780 2013 IFN?/TNF? synergism induces a non-canonical STAT2/IRF9-dependent pathway triggering a novel DUOX2 NADPH oxidase-mediated airway antiviral response.
23457309 2013 Congenital hypothyroidism caused by a novel mutation of the dual oxidase 2 (DUOX2) gene.
23404210 2013 Functional activity and tumor-specific expression of dual oxidase 2 in pancreatic cancer cells and human malignancies characterized with a novel monoclonal antibody.
23362256 2013 Conserved cysteine residues provide a protein-protein interaction surface in dual oxidase (DUOX) proteins.
23296709 2013 Activation of TLR4 is required for the synergistic induction of dual oxidase 2 and dual oxidase A2 by IFN-? and lipopolysaccharide in human pancreatic cancer cell lines.
23281318 2013 Expression of dual oxidases and secreted cytokines in chronic rhinosinusitis.
23225414 2012 DUOX enzyme activity promotes AKT signalling in prostate cancer cells.
23010498 2013 Thyroid hydrogen peroxide production is enhanced by the Th2 cytokines, IL-4 and IL-13, through increased expression of the dual oxidase 2 and its maturation factor DUOXA2.
22814254 2012 The type of DUOX-dependent ROS production is dictated by defined sequences in DUOXA.
22592922 2012 Dual oxidase 2 bidirectional promoter polymorphisms confer differential immune responses in airway epithelia.
22523549 2012 Reactive oxygen species regulate the levels of dual oxidase (Duox1-2) in human neuroblastoma cells.
22336364 2011 [DUOX2 gene mutation in patients with congenital goiter with hypothyroidism].
21915726 2011 NADPH oxidase DUOX1 and DUOX2 but not NOX4 are independent predictors in hepatocellular carcinoma after hepatectomy.
21714724 2012 Dual oxidase 2 is essential for the toll-like receptor 5-mediated inflammatory response in airway mucosa.
21704604 2011 Structural stability and heme binding potential of the truncated human dual oxidase 2 (DUOX2) peroxidase domain.
21565790 2011 Identification and functional analysis of novel dual oxidase 2 (DUOX2) mutations in children with congenital or subclinical hypothyroidism.
21321110 2011 Up-regulation and sustained activation of Stat1 are essential for interferon-gamma (IFN-gamma)-induced dual oxidase 2 (Duox2) and dual oxidase A2 (DuoxA2) expression in human pancreatic cancer cell lines.
21148036 2011 Double-stranded RNA induces shedding of the 34-kDa soluble TNFR1 from human airway epithelial cells via TLR3-TRIF-RIP1-dependent signaling: roles for dual oxidase 2- and caspase-dependent pathways.
20826581 2010 Functional consequences of dual oxidase-thyroperoxidase interaction at the plasma membrane.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20531308 2010 The NADPH oxidases NOX4 and DUOX2 regulate cell cycle entry via a p53-dependent pathway.
20511343 2010 All-trans retinoic acid mediates DUOX2 expression and function in respiratory tract epithelium.
20381453 2010 IFNgamma mediates DUOX2 expression via a STAT-independent signaling pathway.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20187165 2010 Compound heterozygosity for a novel hemizygous missense mutation and a partial deletion affecting the catalytic core of the H2O2-generating enzyme DUOX2 associated with transient congenital hypothyroidism.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19952225 2010 Association of duoxes with thyroid peroxidase and its regulation in thyrocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19789206 2009 Identification and functional studies of two new dual-oxidase 2 (DUOX2) mutations in a child with congenital hypothyroidism and a eutopic normal-size thyroid gland.
19759286 2009 DUOX2-derived reactive oxygen species are effectors of NOD2-mediated antibacterial responses.
19339556 2009 Heterodimerization controls localization of Duox-DuoxA NADPH oxidases in airway cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19144650 2009 Activation of dual oxidases Duox1 and Duox2: differential regulation mediated by camp-dependent protein kinase and protein kinase C-dependent phosphorylation.
18765513 2008 Transient congenital hypothyroidism caused by biallelic mutations of the dual oxidase 2 gene in Japanese patients detected by a neonatal screening program.
18281478 2008 Silencing of DUOX NADPH oxidases by promoter hypermethylation in lung cancer.
18177232 2008 Dual oxidase 1 and 2 expression in airway epithelium of smokers and patients with mild/moderate chronic obstructive pulmonary disease.
17684392 2007 New phenotypes in thyroid dyshormonogenesis: hypothyroidism due to DUOX2 mutations.
17374849 2007 Missense mutations of dual oxidase 2 (DUOX2) implicated in congenital hypothyroidism have impaired trafficking in cells reconstituted with DUOX2 maturation factor.
16651268 2006 Identification of the maturation factor for dual oxidase. Evolution of an eukaryotic operon equivalent.
16608528 2006 Genetic polymorphisms and susceptibility to lung disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16478776 2006 Expression of TPO and ThOXs in human thyrocytes is downregulated by IL-1alpha/IFN-gamma, an effect partially mediated by nitric oxide.
16322276 2006 Three mutations (p.Q36H, p.G418fsX482, and g.IVS19-2A>C) in the dual oxidase 2 gene responsible for congenital goiter and iodide organification defect.
16134168 2005 Persistent mild hypothyroidism associated with novel sequence variants of the DUOX2 gene in two siblings.
16111680 2005 Differential regulation of dual NADPH oxidases/peroxidases, Duox1 and Duox2, by Th1 and Th2 cytokines in respiratory tract epithelium.
15972824 2005 Dual oxidase-2 has an intrinsic Ca2+-dependent H2O2-generating activity.
15677770 2005 Regulated hydrogen peroxide production by Duox in human airway epithelial cells.
15591162 2005 Dual oxidase2 is expressed all along the digestive tract.
15561711 2005 Identification of a novel partner of duox: EFP1, a thioredoxin-related protein.
15210697 2004 NADPH oxidase-dependent acid production in airway epithelial cells.
15150274 2004 Targeting of the dual oxidase 2 N-terminal region to the plasma membrane.
15062544 2004 Structural and functional characterization of the two human ThOX/Duox genes and their 5'-flanking regions.
12824283 2003 Dual oxidases represent novel hydrogen peroxide sources supporting mucosal surface host defense.
12110737 2002 Inactivating mutations in the gene for thyroid oxidase 2 (THOX2) and congenital hypothyroidism.
11822874 2002 Characterization of ThOX proteins as components of the thyroid H(2)O(2)-generating system.
11762710 2001 Expression of nicotinamide adenine dinucleotide phosphate oxidase flavoprotein DUOX genes and proteins in human papillary and follicular thyroid carcinomas.
11753072 2002 Nox/Duox family of nicotinamide adenine dinucleotide (phosphate) oxidases.
11514595 2001 Tyrosine cross-linking of extracellular matrix is catalyzed by Duox, a multidomain oxidase/peroxidase with homology to the phagocyte oxidase subunit gp91phox.
11443211 2001 Expression of reduced nicotinamide adenine dinucleotide phosphate oxidase (ThoX, LNOX, Duox) genes and proteins in human thyroid tissues.
11032719 2000 Thyroid oxidase (THOX2) gene expression in the rat thyroid cell line FRTL-5.
10806195 2000 Cloning of two human thyroid cDNAs encoding new members of the NADPH oxidase family.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10601291 1999 Purification of a novel flavoprotein involved in the thyroid NADPH oxidase. Cloning of the porcine and human cdnas.