Property Summary

NCBI Gene PubMed Count 54
PubMed Score 255.69
PubTator Score 52.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -2.700 2.9e-02
Atopic dermatitis 1.500 1.4e-04
adrenocortical carcinoma -1.742 1.0e-05
non-small cell lung cancer -2.531 1.3e-22
lung cancer -4.300 1.1e-06
sarcoidosis -1.600 2.6e-02
interstitial cystitis -3.000 1.7e-05
lung adenocarcinoma -3.000 1.8e-10
primary Sjogren syndrome -1.100 3.3e-03
nasopharyngeal carcinoma -2.100 8.5e-11
psoriasis 1.400 8.7e-09
Endometriosis -1.915 5.0e-02
lung carcinoma -3.200 1.5e-35
gastric carcinoma -2.000 4.4e-02

Gene RIF (39)

PMID Text
25848056 These data reveal a key role of DUOX1-dependent hydrogen peroxide production in long-term persistent radio-induced DNA damage.
25586178 Duox2 proteins possessing the A-loops of Nox1 or Nox5 co-expressed with DuoxA2 showed enhanced O2 () release, and Duox1 proteins possessing the A-loops of Nox1 or Nox5 co-expressed with DuoxA1 acquired O2 () leakage
25164816 Duox1 activity is stimulated by testosterone through GPRC6A in skin keratinocytes
24624333 Studies demonstrate the importance of DUOX1 in epithelial redox signaling through reversible S-glutathionylation of a range of proteins, including proteins involved in cytoskeletal regulation and MAPK signaling pathways involved in cell migration.
24332816 DUOX1 is the major H2O2-producing source in NHKs stimulated with Ca(2+), and plays a significant role in regulating the expression of specific markers necessary for the normal differentiation of keratinocytes
24164541 Underscore the importance of DUOX1 and DUOX2 in vesicant-induced IL-6 secretion in human airway epithelial cells.
24161126 Despite the high sequence similarity shared between DUOX1 and DUOX2, the two isoforms present distinct regulations, tissue expression and catalytic functions
24128054 Further, ROS generated by Duox enzymes localized adjacent to nuclear speckles altered the splicing of viral genes
23691121 PA-LPS-induced MUC5AC and Clca3 expression is partly through Duox1
23362256 Study indicates a complex profile of protein interactions required for activity and localization of the DUOX1 and DOOX2 enzymes.
23349873 DUOX1 plays a central role in epithelial defense responses to infection or injury, by mediating oxidative activation of Src and ADAM17 in response to ATP-dependent P2Y(2)R activation as a proximal step in EGFR transactivation and downstream signaling.
23281318 upregulated in chronic rhinosinusitis as a part of inflammatory response
23225414 Report shows that ROS levels in PC3 cells are constitutively maintained by DUOX 1 and 2 enzymes, and these ROS positively regulate AKT signalling through inactivating phosphatases, leading to increased resistance to apoptosis.
22523549 study reports DUOX 1 and 2 are expressed in neuroblastoma SK-N-BE cells as well as in an oligodendrocyte cell line (MO3-13); data unravel a novel mechanism of regulation of DUOX enzymes by reactive oxygen species and identify a circuitry linking NADPH oxidase activity to DUOX1 and 2 levels in neuroblastoma cells
21915726 Data show that comparing with adjacent non-neoplastic tissues, DUOX1, DUOX2, and NOX4 were expressed at higher frequencies in tumor specimens.
21411736 Data demonstrated that the increased expression of DUOX1 in IL-4/IL-13-treated NHEK augments STAT6 phosphorylation via oxidative inactivation of protein tyrosine phosphatase 1B.
21389273 results demonstrate Duox1-mediated redox signaling in bronchial epithelial cells is associated with Lipid raft clustering dependent on the production of ceramide through acid sphingomyelinase
20682913 activation of Duox1, downstream of proximal TCR signals, generates H(2)O(2) that acts in a positive feedback loop to enhance and sustain further TCR signaling.
20346360 Observational study of gene-disease association. (HuGE Navigator)
20085766 Results found that Pseudomonas aeruginosa triggers H2O2 production by Duox1 in bronchial epithelial cells in a calcium-dependent but predominantly ATP-independent manner.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19952225 TPO binds to dualoxidases;defects in this association could impair thyroid hormone synthesis and lead to thyroid insufficiency and cell damage.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19460756 analysis of heme binding and catalytic activity of Caenorhabditis elegans and human dual oxidase 1
19339556 Heterodimerization controls localization of Duox-DuoxA NADPH oxidases in airway cells.
19144650 Activation of dual oxidases Duox1 and Duox2: differential regulation mediated by camp-dependent protein kinase and protein kinase C-dependent phosphorylation.
18606821 a novel, inhibitory function for Noxa1 in Duox1 regulation.
18281478 Results suggest that an area on chromosome 15 that includes DUOX1, DUOX2, and their maturation factors is a frequent target for epigenetic silencing in lung cancer.
18177232 Results imply that the airway expression of Duox1 is diversely associated with smoking and chronic obstructive pulmonary disease.
17337509 there is regulated expression of DUOX1 during alveolar maturation, and DUOX1 mediates alveolar H(2)O(2) and acid secretion by differentiated type II cells
17135261 Critical role for dual oxidase 1 within the tracheobronchial epithelium, in airway epithelial cell migration and repair following injury.
16608528 Observational study of gene-disease association. (HuGE Navigator)
16478776 In conclusion, incubation of normal or GD thyrocytes with Th1 cytokines induces a significant reduction in TSH-increased expression of both TPO and ThOXs, an effect partially mediated by NO.
16111680 Results demonstrate the regulation of Duox1 and 2 expression by Th1 and Th2 cytokines, and suggest a mechanism by which ROS production can be regulated in the respiratory tract as part of the host defense response.
15677770 These data suggest that Duox1 and 2 are the major NADPH oxidases expressed in airway epithelia and therefore contributors of hydrogen peroxide production in the airway lumen.
15640347 Duox1 plays a critical role in mucin expression by airway epithelial cells through PKCdelta/PKC-Duox1-ROS-TACE-pro-ligand-EGF receptor cascade.
15561711 EFP1 is a thioredoxin-related protein and partner of duox
15062544 chromosomal organization of hThOX1 and hThOX2 genes and the functional characterization of their respective promoter regions
12482831 Thox1 is expressed in aortic media and either not at all or rarely in unaffected intima, while mRNA expression in cells is greatest in fibrofatty lesions.

AA Sequence

MGFCLALAWTLLVGAWTPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYADGVYQPLGEP      1 - 70
HLPNPRDLSNTISRGPAGLASLRNRTVLGVFFGYHVLSDLVSVETPGCPAEFLNIRIPPGDPMFDPDQRG     71 - 140
DVVLPFQRSRWDPETGRSPSNPRDPANQVTGWLDGSAIYGSSHSWSDALRSFSRGQLASGPDPAFPRDSQ    141 - 210
NPLLMWAAPDPATGQNGPRGLYAFGAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHAR    211 - 280
KRVIATYQNIAVYEWLPSFLQKTLPEYTGYRPFLDPSISSEFVAASEQFLSTMVPPGVYMRNASCHFQGV    281 - 350
INRNSSVSRALRVCNSYWSREHPSLQSAEDVDALLLGMASQIAEREDHVLVEDVRDFWPGPLKFSRTDHL    351 - 420
ASCLQRGRDLGLPSYTKARAALGLSPITRWQDINPALSRSNDTVLEATAALYNQDLSWLELLPGGLLESH    421 - 490
RDPGPLFSTIVLEQFVRLRDGDRYWFENTRNGLFSKKEIEEIRNTTLQDVLVAVINIDPSALQPNVFVWH    491 - 560
KGDPCPQPRQLSTEGLPACAPSVVRDYFEGSGFGFGVTIGTLCCFPLVSLLSAWIVARLRMRNFKRLQGQ    561 - 630
DRQSIVSEKLVGGMEALEWQGHKEPCRPVLVYLQPGQIRVVDGRLTVLRTIQLQPPQKVNFVLSSNRGRR    631 - 700
TLLLKIPKEYDLVLLFNLEEERQALVENLRGALKESGLSIQEWELREQELMRAAVTREQRRHLLETFFRH    701 - 770
LFSQVLDINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLSFREF    771 - 840
LDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNNCLSKAQLAEVVESMFRESGFQ    841 - 910
DKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETE    911 - 980
LTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLHQTVQQFKRFIENYRRHIGCVAV    981 - 1050
FYAIAGGLFLERAYYYAFAAHHTGITDTTRVGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRY   1051 - 1120
VPFDAAVDFHRLIASTAIVLTVLHSVGHVVNVYLFSISPLSVLSCLFPGLFHDDGSELPQKYYWWFFQTV   1121 - 1190
PGLTGVVLLLILAIMYVFASHHFRRRSFRGFWLTHHLYILLYVLLIIHGSFALIQLPRFHIFFLVPAIIY   1191 - 1260
GGDKLVSLSRKKVEISVVKAELLPSGVTHLRFQRPQGFEYKSGQWVRIACLALGTTEYHPFTLTSAPHED   1261 - 1330
TLSLHIRAAGPWTTRLREIYSAPTGDRCARYPKLYLDGPFGEGHQEWHKFEVSVLVGGGIGVTPFASILK   1331 - 1400
DLVFKSSVSCQVFCKKIYFIWVTRTQRQFEWLADIIREVEENDHQDLVSVHIYITQLAEKFDLRTTMLYI   1401 - 1470
CERHFQKVLNRSLFTGLRSITHFGRPPFEPFFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLINRQD   1471 - 1540
RTHFSHHYENF                                                              1541 - 1551
//

Text Mined References (55)

PMID Year Title
25848056 2015 NADPH oxidase DUOX1 promotes long-term persistence of oxidative stress after an exposure to irradiation.
25586178 2015 The extracellular A-loop of dual oxidases affects the specificity of reactive oxygen species release.
25164816 2014 Testosterone stimulates Duox1 activity through GPRC6A in skin keratinocytes.
24624333 2014 Identification of DUOX1-dependent redox signaling through protein S-glutathionylation in airway epithelial cells.
24332816 2014 Hydrogen peroxide generated by DUOX1 regulates the expression levels of specific differentiation markers in normal human keratinocytes.
24164541 2014 Role of nicotinamide adenine dinucleotide phosphate oxidase in mediating vesicant-induced interleukin-6 secretion in human airway epithelial cells.
24161126 2014 Roles of DUOX-mediated hydrogen peroxide in metabolism, host defense, and signaling.
24128054 2014 Mucosal reactive oxygen species are required for antiviral response: role of Duox in influenza a virus infection.
23691121 2013 P. aeruginosa lipopolysaccharide-induced MUC5AC and CLCA3 expression is partly through Duox1 in vitro and in vivo.
23362256 2013 Conserved cysteine residues provide a protein-protein interaction surface in dual oxidase (DUOX) proteins.
23349873 2013 ATP-mediated transactivation of the epidermal growth factor receptor in airway epithelial cells involves DUOX1-dependent oxidation of Src and ADAM17.
23281318 2013 Expression of dual oxidases and secreted cytokines in chronic rhinosinusitis.
23225414 2012 DUOX enzyme activity promotes AKT signalling in prostate cancer cells.
22523549 2012 Reactive oxygen species regulate the levels of dual oxidase (Duox1-2) in human neuroblastoma cells.
21915726 2011 NADPH oxidase DUOX1 and DUOX2 but not NOX4 are independent predictors in hepatocellular carcinoma after hepatectomy.
21411736 2011 Dual oxidase 1 induced by Th2 cytokines promotes STAT6 phosphorylation via oxidative inactivation of protein tyrosine phosphatase 1B in human epidermal keratinocytes.
21389273 2011 Lipid raft-dependent activation of dual oxidase 1/H2O2/NF-?B pathway in bronchial epithelial cells.
20709024 2010 Dual oxidase in the intestinal epithelium of zebrafish larvae has anti-bacterial properties.
20682913 2010 The nonphagocytic NADPH oxidase Duox1 mediates a positive feedback loop during T cell receptor signaling.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20085766 2010 Characterization of hydrogen peroxide production by Duox in bronchial epithelial cells exposed to Pseudomonas aeruginosa.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19952225 2010 Association of duoxes with thyroid peroxidase and its regulation in thyrocytes.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19460756 2009 Caenorhabditis elegans and human dual oxidase 1 (DUOX1) "peroxidase" domains: insights into heme binding and catalytic activity.
19339556 2009 Heterodimerization controls localization of Duox-DuoxA NADPH oxidases in airway cells.
19144650 2009 Activation of dual oxidases Duox1 and Duox2: differential regulation mediated by camp-dependent protein kinase and protein kinase C-dependent phosphorylation.
18606821 2008 Inhibitory action of NoxA1 on dual oxidase activity in airway cells.
18281478 2008 Silencing of DUOX NADPH oxidases by promoter hypermethylation in lung cancer.
18177232 2008 Dual oxidase 1 and 2 expression in airway epithelium of smokers and patients with mild/moderate chronic obstructive pulmonary disease.
17337509 2007 Developmental regulation of DUOX1 expression and function in human fetal lung epithelial cells.
17135261 2007 Airway epithelial cell migration and wound repair by ATP-mediated activation of dual oxidase 1.
16608528 2006 Genetic polymorphisms and susceptibility to lung disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16478776 2006 Expression of TPO and ThOXs in human thyrocytes is downregulated by IL-1alpha/IFN-gamma, an effect partially mediated by nitric oxide.
16111680 2005 Differential regulation of dual NADPH oxidases/peroxidases, Duox1 and Duox2, by Th1 and Th2 cytokines in respiratory tract epithelium.
15972824 2005 Dual oxidase-2 has an intrinsic Ca2+-dependent H2O2-generating activity.
15677770 2005 Regulated hydrogen peroxide production by Duox in human airway epithelial cells.
15640347 2005 Dual oxidase 1-dependent MUC5AC mucin expression in cultured human airway epithelial cells.
15561711 2005 Identification of a novel partner of duox: EFP1, a thioredoxin-related protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15210697 2004 NADPH oxidase-dependent acid production in airway epithelial cells.
15062544 2004 Structural and functional characterization of the two human ThOX/Duox genes and their 5'-flanking regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12824283 2003 Dual oxidases represent novel hydrogen peroxide sources supporting mucosal surface host defense.
12482831 2002 Cytochrome b558-dependent NAD(P)H oxidase-phox units in smooth muscle and macrophages of atherosclerotic lesions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11822874 2002 Characterization of ThOX proteins as components of the thyroid H(2)O(2)-generating system.
11762710 2001 Expression of nicotinamide adenine dinucleotide phosphate oxidase flavoprotein DUOX genes and proteins in human papillary and follicular thyroid carcinomas.
11753072 2002 Nox/Duox family of nicotinamide adenine dinucleotide (phosphate) oxidases.
11514595 2001 Tyrosine cross-linking of extracellular matrix is catalyzed by Duox, a multidomain oxidase/peroxidase with homology to the phagocyte oxidase subunit gp91phox.
11443211 2001 Expression of reduced nicotinamide adenine dinucleotide phosphate oxidase (ThoX, LNOX, Duox) genes and proteins in human thyroid tissues.
10806195 2000 Cloning of two human thyroid cDNAs encoding new members of the NADPH oxidase family.
10601291 1999 Purification of a novel flavoprotein involved in the thyroid NADPH oxidase. Cloning of the porcine and human cdnas.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.