Property Summary

NCBI Gene PubMed Count 15
PubMed Score 105.19
PubTator Score 43.49

Knowledge Summary

Patent (12,936)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.200 3.8e-04
atypical teratoid / rhabdoid tumor 1.100 2.4e-06
glioblastoma 1.400 2.2e-09
group 3 medulloblastoma 1.600 3.3e-05
medulloblastoma, large-cell 1.500 7.6e-05
non-small cell lung cancer 1.354 3.1e-24
osteosarcoma -1.415 2.4e-03
primitive neuroectodermal tumor 1.300 3.4e-04

PDB (21)

Gene RIF (1)

AA Sequence

MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL      1 - 70
LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA     71 - 140
AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL    141 - 210
WK                                                                        211 - 212
//

Text Mined References (20)

PMID Year Title