Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.48
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.600 8.2e-17
glioblastoma 2.300 6.6e-10
oligodendroglioma 1.300 3.1e-11
posterior fossa group A ependymoma 2.100 2.1e-09
juvenile dermatomyositis 3.231 1.6e-21
primary pancreatic ductal adenocarcinoma 1.095 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.0e-02
active Crohn's disease 1.147 3.3e-03
Multiple Sclerosis 1.400 5.7e-03
pediatric high grade glioma 2.400 4.3e-07
group 4 medulloblastoma -1.200 9.7e-03
pilocytic astrocytoma 2.600 6.3e-10
primary Sjogren syndrome 1.300 3.6e-03
subependymal giant cell astrocytoma 2.762 2.6e-03
inflammatory breast cancer 1.100 1.5e-03
ovarian cancer 1.900 9.6e-05
psoriasis 1.500 1.1e-125

Gene RIF (8)

PMID Text
24886089 The present study further suggests that the combined targeted inhibition of STAT1, ARTD8, ARTD9 and/or DTX3L could increase the efficacy of chemotherapy or radiation treatment in prostate and other high-risk tumor types with an increased STAT1 signaling.
24790097 A novel role for the really interesting new gene-domain E3 ubiquitin ligase deltex-3-like (DTX3L) in regulating CXCR4 sorting from endosomes to lysosomes.
23230272 Data establish that BAL1 and BBAP are bona fide members of a DNA damage response pathway and are directly associated with PARP1 activation, BRCA1 recruitment, and double-strand break repair.
22411408 we report the high-resolution crystal structure of this previously uncharacterized C-terminal domain of human DTX3L, which we term the Deltex C-terminal domain.
19818714 Data directly implicate BBAP in the monoubiquitylation and additional posttranslational modification of histone H4 and an associated DNA damage response.
18618715 Overexpression of DTX3L, PIK3R4, ATP2C1, and SLC25A36, all located at 3q21.1-23 are associated with cervical cancer.
16809771 BAL1 and BBAP are located on chromosome 3q21 in a head-to-head orientation and are regulated by a IFN-gamma-responsive bidirectional promoter.
12670957 It is reported that BBAP and the human family of DTX proteins (DTX1, DTX2, and DTX3) function as E3 ligases based on their capacity for self-ubiquitination.

AA Sequence

MASHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKK      1 - 70
GEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAETPSGDMHQHEGHIPNAVDSCLQKIFLTVTA     71 - 140
DLNCNLFSKEQRAYITTLCPSIRKMEGHDGIEKVCGDFQDIERIHQFLSEQFLESEQKQQFSPSMTERKP    141 - 210
LSQQERDSCISPSEPETKAEQKSNYFEVPLPYFEYFKYICPDKINSIEKRFGVNIEIQESSPNMVCLDFT    211 - 280
SSRSGDLEAARESFASEFQKNTEPLKQECVSLADSKQANKFKQELNHQFTKLLIKEKGGELTLLGTQDDI    281 - 350
SAAKQKISEAFVKIPVKLFAANYMMNVIEVDSAHYKLLETELLQEISEIEKRYDICSKVSEKGQKTCILF    351 - 420
ESKDRQVDLSVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPNVHFVLNQESM    421 - 490
TLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASPPLKGSVSSEASELDKKEKGI    491 - 560
CVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQTSYGIQKGNQPEGSMVFTVSRDSLPGYESF    561 - 630
GTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDV    631 - 700
ITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE                                  701 - 740
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24886089 2014 DTX3L and ARTD9 inhibit IRF1 expression and mediate in cooperation with ARTD8 survival and proliferation of metastatic prostate cancer cells.
24790097 2014 The ubiquitin ligase deltex-3l regulates endosomal sorting of the G protein-coupled receptor CXCR4.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23230272 2013 BAL1 and its partner E3 ligase, BBAP, link Poly(ADP-ribose) activation, ubiquitylation, and double-strand DNA repair independent of ATM, MDC1, and RNF8.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
22411408 2012 Fold of the conserved DTC domain in Deltex proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19818714 2009 BBAP monoubiquitylates histone H4 at lysine 91 and selectively modulates the DNA damage response.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18618715 2008 Integrated genomic and transcriptional profiling identifies chromosomal loci with altered gene expression in cervical cancer.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16809771 2006 BAL1 and BBAP are regulated by a gamma interferon-responsive bidirectional promoter and are overexpressed in diffuse large B-cell lymphomas with a prominent inflammatory infiltrate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12670957 2003 The BAL-binding protein BBAP and related Deltex family members exhibit ubiquitin-protein isopeptide ligase activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.