Property Summary

NCBI Gene PubMed Count 20
PubMed Score 56.89
PubTator Score 16.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Brain Neoplasms 23
Disease Target Count P-value
malignant mesothelioma 3163 2.1e-05
Disease Target Count Z-score Confidence
Lice infestation 16 4.256 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 2.1e-05

Gene RIF (2)

PMID Text
17286044 DTX2 is a gene encoding a WWE-RING-finger protein and involved in regulating heart development and heart functions.
12670957 It is reported that BBAP and the human family of DTX proteins (DTX1, DTX2, and DTX3) function as E3 ligases based on their capacity for self-ubiquitination.

AA Sequence

MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADP      1 - 70
SLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGN     71 - 140
QLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPV    141 - 210
SGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLY    211 - 280
RSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPV    281 - 350
CLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS    351 - 420
TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEV    421 - 490
LRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRL    491 - 560
IFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ            561 - 622
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17286044 2006 cDNA cloning, characterization and expression analysis of DTX2, a human WWE and RING-finger gene, in human embryos.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16400609 2006 Single-nucleotide polymorphisms in NAGNAG acceptors are highly predictive for variations of alternative splicing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12670957 2003 The BAL-binding protein BBAP and related Deltex family members exhibit ubiquitin-protein isopeptide ligase activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11564735 2001 Role of Deltex-1 as a transcriptional regulator downstream of the Notch receptor.
11226752 2001 Murine homologs of deltex define a novel gene family involved in vertebrate Notch signaling and neurogenesis.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9847074 1998 Toward a complete human genome sequence.
7671825 1995 Deltex acts as a positive regulator of Notch signaling through interactions with the Notch ankyrin repeats.