Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.03
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.900 6.7e-03
oligodendroglioma -1.600 1.7e-02
glioblastoma -2.700 1.7e-05
osteosarcoma 1.778 5.1e-06
ependymoma -1.200 2.7e-04
atypical teratoid / rhabdoid tumor -2.300 5.6e-05
medulloblastoma, large-cell -2.000 1.5e-03
primitive neuroectodermal tumor -1.400 4.6e-03
intraductal papillary-mucinous carcinoma... -1.100 1.9e-03
adult high grade glioma -2.200 9.0e-05
pilocytic astrocytoma -1.600 2.8e-05
sonic hedgehog group medulloblastoma 1.300 1.4e-05
ovarian cancer -1.100 2.6e-07

Synonym

Accession Q8N5C7 Q567Q3 Q8WVG9 Q9NRU6
Symbols MDS009

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCY      1 - 70
TCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALI     71 - 140
FPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWN    141 - 210
QTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFF    211 - 280
YSFMYQLIKNAKCSGDKETGKLTH                                                  281 - 304
//

Text Mined References (5)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.