Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.03
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.200 9.0e-05
astrocytic glioma -1.900 6.7e-03
Astrocytoma, Pilocytic -1.700 1.8e-05
atypical teratoid / rhabdoid tumor -2.300 5.6e-05
ependymoma -1.200 2.7e-04
glioblastoma -1.700 1.3e-05
intraductal papillary-mucinous carcinoma... -1.100 1.9e-03
medulloblastoma, large-cell -2.000 1.5e-03
oligodendroglioma -1.600 1.7e-02
osteosarcoma 1.778 5.1e-06
ovarian cancer -1.100 2.6e-07
primitive neuroectodermal tumor -1.400 4.6e-03
sonic hedgehog group medulloblastoma 1.300 1.4e-05

AA Sequence

MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCY      1 - 70
TCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALI     71 - 140
FPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWN    141 - 210
QTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFF    211 - 280
YSFMYQLIKNAKCSGDKETGKLTH                                                  281 - 304
//

Text Mined References (5)

PMID Year Title