Property Summary

NCBI Gene PubMed Count 179
PubMed Score 286.59
PubTator Score 243.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 5.5e-04
astrocytic glioma -1.900 7.8e-03
atypical teratoid / rhabdoid tumor -1.200 1.5e-04
ependymoma -1.800 2.0e-02
group 4 medulloblastoma -1.500 5.9e-06
intraductal papillary-mucinous neoplasm ... -1.300 1.4e-02
medulloblastoma, large-cell -1.600 2.3e-02
oligodendroglioma -1.900 1.6e-02

Gene RIF (197)

AA Sequence

MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCA      1 - 70
SAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCG     71 - 140
QCELERCKHMQSQQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQY    141 - 210
LSTGYLQIAERREPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNE    211 - 280
ITLQVPNPSELRAKPPSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSD    281 - 350
S//

Text Mined References (186)

PMID Year Title