Property Summary

NCBI Gene PubMed Count 77
PubMed Score 490.37
PubTator Score 403.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -1.900 3.3e-02
spina bifida -2.354 1.7e-02
Breast cancer -2.300 3.7e-11

Gene RIF (48)

PMID Text
26498522 Oxidized low-density lipoprotein attenuated desmoglein 1 and desmocollin 2 expression in human umbilical vein endothelial cells.
26169895 Desmoglein 1 mutation as cause of SAM syndrome
24594668 Ectopic expression of Dsg1 in keratinocyte monolayers rescued the UVB-induced differentiation defect
24220297 Desmoglein-1 regulates esophageal epithelial barrier function and immune responses in eosinophilic esophagitis.
23974871 DSG1 deficiency was associated with increased expression of a number of genes encoding allergy-related cytokines
23940119 The loss of Bcr or MAL reduced levels of Dsg1 mRNA in keratinocytes, and ectopic expression of Dsg1 rescued defects in differentiation seen upon loss of Bcr or MAL signaling.
23524970 DSG1 and Erbin cooperate to repress MAPK signaling and promote keratinocyte differentiation.
23489520 IgG autoantibodies against Dsg1 are mostly raised against preDsg1 and/or C-terminal domains of Dsg1 in healthy Tunisians in the endemic area of pemphigus foliaceus.
23297065 The data showed that serum autoantibodies of patients, previously identified as Dsg1 and Dsg3 positive, are able to recognize continuous linear epitope regions of both Dsg1 and Dsg3 proteins using pin-bound overlapping peptides in modified ELISAs.
22798673 we show that the LJM11 salivary protein from the sand fly are recognized by pemphigus foliaceus autoantibodies against desmoglein 1
22276604 Induced gene expression levels of plakoglobin, desmoglein-1 and desmoglein-2 correlated significantly with dilatation of intercellular spaces and basal cell hyperplasia in esophageal mucosa of patients with gastro-oesophageal reflux disease.
22189787 The identification of desmogleins 1 and 3, desmosomal adhesion glycoproteins, as targets in pemphigus, a fatal autoimmune blistering disease of the skin and mucous membranes, provided the first link between desmosomes, desmogleins, and human diseases.
21191415 anti-DSG1 response in fogo selvagem patients may be initiated by sensitization to an environmental allergen
21163944 KLK5 may promote metastatic dissemination of OSCC by promoting loss of junctional integrity through cleavage of desmoglein 1.
21075858 Histone deacetylase inhibition up-regulates desmosomal cadherins and prevents the loss of adhesion induced by Dsg1 truncation.
20861311 Data show that desmoglein 1 expression was required for the adhesive effects of EphA2.
20116975 localized on corneodesmosomes involved in adhesion
19717567 loss of heterophilic Dsc3/Dsg1 binding may contribute to pemphigus skin blistering
19571823 the anti-DSG1 response in pemphigus foliaceus is antigen driven and that selection for mutant anti-DSG1 B cells begins well before the onset of disease
19546243 Data show that Dsg1 is required for maintaining epidermal tissue integrity in superficial layers, supports keratinocyte differentiation and suprabasal morphogenesis, and is required for suppression of epidermal growth factor receptor signaling.
19453789 Pemphigus foliaceus is an autoimmune blistering skin disease characterized by the production of pathogenic IgG autoantibodies directed against desmoglein 1.
19157795 Mutations in the desmoglein 1 gene have been indentified in five Pakistani families with striate palmoplantar keratoderma.
19136012 The desmoglein-specific cytoplasmic region is an intrinsically disordered functional domain with an inducible structure that, along with the membrane proximal region, forms a flexible scaffold for cytoplasmic assembly at the desmosome.
19018793 Direct sequencing of cDNA derived from affected skin in one patient failed to reveal a pathogenic mutation, suggesting that SPPK results from haploinsufficiency for DSG1.
18752129 Decreased expression of desmoglein 1 is associated with a worse prognosis in head and neck squamous cell carcinoma patients
18637128 The level of Dsg1, a marker of differentiating keratinocytes, was antagonistically regulated by two Ca-independent 'novel' nPKC isoforms; i.e. it increased by the differentiation-promoting nPKCdelta and decreased by the growth-promoting nPKCepsilon.
18331528 findings show that mRNA of the DSG1 gene is present in normal thymus and that the expression of DSG1 transcript increases with age
17960181 IgM anti-Dsg1 are common in fogo selvagem patients in their native environment and uncommon in other pemphigus phenotypes
17640963 Data show that both pemphigus foliaceus-IgG containing Dsg 1- but not Dsg 3-specific antibodies and pemphigus vulgaris-IgG with antibodies to Dsg 1 and Dsg 3 were effective in causing epidermal splitting in human skin and keratinocyte dissociation.
17194569 novel splice site mutation in the DSG1 gene in palmoplantar keratoderma
17058228 Taken together, our results represent the first demonstration that anti-Dsg1 antibodies induce similar alterations on the subcellular distribution of Dsg1 irrespective of the disease where they come from.
17056584 An alternative transcript of DSG1, which contains a 101-bp insertion corresponding to the 3' end of DSG1-intron 6 and introducing a stop codon in the nucleotide sequence, is described.
16628198 in majority of patients with Netherton syndrome, Dsg1 & Dsc1 were reduced in living layers of epidermis; SCTE-like & SCCE-like activities were increased, suggesting these proteases participate in premature degradation of corneodesmosomal cadherins
16484817 perturbation of desmoglein 1 expression has a critical impact on the integrity of tissues experiencing strong mechanical stress.
16286477 desmoglein 1 is a novel caspase-3 target that regulates apoptosis in keratinocytes
16242304 No significant relationship is revealed between genetic variants of autoantigen desmoglein 1 and pemphigus foliaceus in the Brazilian population.
16026580 T-cell autoreactivity against Dsg1 is seen both in patients with pemphigus foliaceus and in healthy individuals
15610512 a component of insect vector saliva, rather than the parasite itself may trigger an antibody response to EC-5 domain of desmoglein 1
15606501 Dsg1 promotes the formation of intercellular adhesion complexes.
14675185 a detailed epitope mapping reveals that the conformational epitopes recognized by IgG1 autoantibodies from these PF patients are restricted to the first 161 amino acids of Dsg1, whereas the linear epitopes are spread throughout the entire ectodomain.
12880431 Specificity of exfoliative toxin cleavage of desmoglein 1 resides not only in simple amino acid sequences but also in its calcium-dependent conformation.
12880414 Signaling pathway initiated by structural changes in the adherens junction in which adherens-junction-derived plakoglobin regulates nuclear transcription by antagonizing the binding of beta-catenin to T cell factor/lymphoid enhancer factor proteins.
12787134 Desmoglein 1 defined more differentiated cell populations, and was expressed in epidermal suprabasal cells, the inner root sheath, and the innermost layers of the outer root sheath.
12485422 During high-level expression, keratin insertion at cell-cell contact sites was inhibited in desmoglein 1 but not in desmoglein 3, and desmoplakin was stained at cell-cell contact sites in desmoglein 3 but not in desmoglein 1.
12209366 Observational study of gene-disease association. (HuGE Navigator)
12093888 Staphylococcal exfoliative toxins act as serine proteases with extremely focused molecular specificity to cleave mouse and human desmoglein 1 (Dsg1) once after glutamic acid residue 381 between extracellular domains 3 and 4.
12058255 data demonstrate the role of epistasis between individual genes in Pemphigus foliaceus susceptibility and illustrate the genetic complexity of organ-specific autoimmune diseases; Epistasis between DSG1 and HLA class II genes
11294567 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACREGEDNSKRNPI      1 - 70
AKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERP     71 - 140
LELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFI    141 - 210
INRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQE    211 - 280
NTLNSNLLEIRVIDLDEEFSANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIG    281 - 350
VRNKAEFHHSIMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTT    351 - 420
VRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDD    421 - 490
RTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLLSDNVHFGPAGIGLLIMGFLV    491 - 560
LGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVEGPQPEPRDITTVIPQIPPDNANIIECIDNS    561 - 630
GVYTNEYGGREMQDLGGGERMTGFELTEGVKTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQ    631 - 700
KAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPD    701 - 770
LDPSWPPQSTEPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTES    771 - 840
YTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIAPSSSLPTSLT    841 - 910
IHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAGVTGISGTTGISGGIGSSGLV    911 - 980
GTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYSK     981 - 1049
//

Text Mined References (82)

PMID Year Title
26498522 2015 Oxidized low-density lipoprotein attenuated desmoglein 1 and desmocollin 2 expression via LOX-1/Ca(2+)/PKC-? signal in human umbilical vein endothelial cells.
26169895 2015 [Homozygous desmoglein 1 gene mutations and severe dermatitis, multiple allergies and metabolic wasting (SAM syndrome)].
25468811 2015 Expression of desmogleins 1-3 and their clinical impacts on human lung cancer.
25231147 2014 Heterogeneous and abnormal localization of desmosomal proteins in oral intraepithelial neoplasms.
25041099 2015 Loss of desmoglein 1 associated with palmoplantar keratoderma, dermatitis and multiple allergies.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24849508 2014 Aberrant expression and altered cellular localization of desmosomal and hemidesmosomal proteins are associated with aggressive clinicopathological features of oral squamous cell carcinoma.
24594668 2014 The desmosomal protein desmoglein 1 aids recovery of epidermal differentiation after acute UV light exposure.
24220297 2014 Desmoglein-1 regulates esophageal epithelial barrier function and immune responses in eosinophilic esophagitis.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23974871 2013 Desmoglein 1 deficiency results in severe dermatitis, multiple allergies and metabolic wasting.
23940119 2013 The GEF Bcr activates RhoA/MAL signaling to promote keratinocyte differentiation via desmoglein-1.
23524970 2013 Desmoglein-1/Erbin interaction suppresses ERK activation to support epidermal differentiation.
23489520 2013 Autoimmune reactivity against precursor form of desmoglein 1 in healthy Tunisians in the area of endemic pemphigus foliaceus.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23297065 2013 The mapping of linear B-cell epitope regions in the extracellular parts of the desmoglein 1 and 3 proteins: recognition of immobilized peptides by pemphigus patients' serum autoantibodies.
22798673 2012 Cutting Edge: Brazilian pemphigus foliaceus anti-desmoglein 1 autoantibodies cross-react with sand fly salivary LJM11 antigen.
22276604 2012 Gastro-oesophageal reflux disease is associated with up-regulation of desmosomal components in oesophageal mucosa.
22189787 2012 Desmoglein as a target in skin disease and beyond.
21269460 2011 Initial characterization of the human central proteome.
21191415 2011 IgE, IgM, and IgG4 anti-desmoglein 1 autoantibody profile in endemic pemphigus foliaceus (fogo selvagem).
21163944 2011 Kallikrein-5 promotes cleavage of desmoglein-1 and loss of cell-cell cohesion in oral squamous cell carcinoma.
21075858 2010 Plakoglobin rescues adhesive defects induced by ectodomain truncation of the desmosomal cadherin desmoglein 1: implications for exfoliative toxin-mediated skin blistering.
20861311 2010 Ligand targeting of EphA2 enhances keratinocyte adhesion and differentiation via desmoglein 1.
20208534 2010 Common variants at 5q22 associate with pediatric eosinophilic esophagitis.
20116975 2010 Bidimensional analysis of desmoglein 1 distribution on the outermost corneocytes provides the structural and functional information of the stratum corneum.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19759396 2009 Interactions of plakoglobin and beta-catenin with desmosomal cadherins: basis of selective exclusion of alpha- and beta-catenin from desmosomes.
19717567 2009 Desmocollin 3-mediated binding is crucial for keratinocyte cohesion and is impaired in pemphigus.
19571823 2009 Antigen selection of anti-DSG1 autoantibodies during and before the onset of endemic pemphigus foliaceus.
19546243 2009 Desmoglein 1-dependent suppression of EGFR signaling promotes epidermal differentiation and morphogenesis.
19453789 2009 Anti-desmoglein 1 antibodies in healthy related and unrelated subjects and patients with pemphigus foliaceus in endemic and non-endemic areas from Tunisia.
19157795 2009 Mutations in the desmoglein 1 gene in five Pakistani families with striate palmoplantar keratoderma.
19136012 2009 The desmoglein-specific cytoplasmic region is intrinsically disordered in solution and interacts with multiple desmosomal protein partners.
19018793 2009 Novel mutations in DSG1 causing striate palmoplantar keratoderma.
18752129 2008 Loss of desmoglein 1 expression associated with worse prognosis in head and neck squamous cell carcinoma patients.
18637128 2009 Protein kinase C isoenzymes differentially regulate the differentiation-dependent expression of adhesion molecules in human epidermal keratinocytes.
18331528 2008 Expression of pemphigus-autoantigen desmoglein 1 in human thymus.
17960181 2008 The IgM anti-desmoglein 1 response distinguishes Brazilian pemphigus foliaceus (fogo selvagem) from other forms of pemphigus.
17640963 2007 Pemphigus IgG causes skin splitting in the presence of both desmoglein 1 and desmoglein 3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17194569 2007 Striate palmoplantar keratoderma resulting from a frameshift mutation in the desmoglein 1 gene.
17058228 2007 Changes in desmoglein 1 expression and subcellular localization in cultured keratinocytes subjected to anti-desmoglein 1 pemphigus autoimmunity.
17056584 2006 A truncated alternative spliced isoform of human desmoglein 1 contains a specific T cell epitope binding to the pemphigus foliaceus-associated HLA class II DRbeta1*0102 molecule.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16628198 2006 Corneodesmosomal cadherins are preferential targets of stratum corneum trypsin- and chymotrypsin-like hyperactivity in Netherton syndrome.
16484817 2006 Focal palmoplantar keratoderma caused by an autosomal dominant inherited mutation in the desmoglein 1 gene.
16286477 2006 The differentiation-dependent desmosomal cadherin desmoglein 1 is a novel caspase-3 target that regulates apoptosis in keratinocytes.
16242304 2005 Pemphigus foliaceus and desmoglein 1 gene polymorphism: is there any relationship?
16177791 2005 DNA sequence and analysis of human chromosome 18.
16026580 2005 Ex vivo analysis of desmoglein 1-responsive T-helper (Th) 1 and Th2 cells in patients with pemphigus foliaceus and healthy individuals.
15610512 2004 Anti-desmoglein-1 antibodies in onchocerciasis, leishmaniasis and Chagas disease suggest a possible etiological link to Fogo selvagem.
15606501 2004 Coordinated expression of desmoglein 1 and desmocollin 1 regulates intercellular adhesion.
15140227 2004 Degradation of corneodesmosome proteins by two serine proteases of the kallikrein family, SCTE/KLK5/hK5 and SCCE/KLK7/hK7.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675185 2003 Pathogenicity and epitope characteristics of anti-desmoglein-1 from pemphigus foliaceus patients expressing only IgG1 autoantibodies.
12880431 2003 Calcium-dependent conformation of desmoglein 1 is required for its cleavage by exfoliative toxin.
12880414 2003 Keratinocyte adherens junctions initiate nuclear signaling by translocation of plakoglobin from the membrane to the nucleus.
12847106 2003 Plakoglobin is O-glycosylated close to the N-terminal destruction box.
12787134 2003 Desmoglein isotype expression in the hair follicle and its cysts correlates with type of keratinization and degree of differentiation.
12707304 2003 Defining desmosomal plakophilin-3 interactions.
12582396 2003 Desmoglein as a target in autoimmunity and infection.
12485422 2002 Differential effects of desmoglein 1 and desmoglein 3 on desmosome formation.
12209366 2002 Tunisian endemic pemphigus foliaceus is associated with desmoglein 1 gene polymorphism.
12093888 2002 Molecular mechanisms of blister formation in bullous impetigo and staphylococcal scalded skin syndrome.
12058255 2002 Epistasis between DSG1 and HLA class II genes in pemphigus foliaceus.
11790773 2002 Protein binding and functional characterization of plakophilin 2. Evidence for its diverse roles in desmosomes and beta -catenin signaling.
11294567 2001 A polymorphic variant of the gene coding desmoglein 1, the target autoantigen of pemphigus foliaceus, is associated with the disease.
10332028 1999 N-terminal deletion in a desmosomal cadherin causes the autosomal dominant skin disease striate palmoplantar keratoderma.
9606214 1998 Defining the interactions between intermediate filaments and desmosomes.
9443898 1998 Coexpression of both types of desmosomal cadherin and plakoglobin confers strong intercellular adhesion.
9405290 1998 Characterization of the regulatory regions in the human desmoglein genes encoding the pemphigus foliaceous and pemphigus vulgaris antigens.
8143788 1994 Identification of the ubiquitous human desmoglein, Dsg2, and the expression catalogue of the desmoglein subfamily of desmosomal cadherins.
8034325 1994 The human genes for desmogleins (DSG1 and DSG3) are located in a small region on chromosome 18q12.
7983064 1994 Posttranslational regulation of plakoglobin expression. Influence of the desmosomal cadherins on plakoglobin metabolic stability.
7790000 1995 Tandem arrangement of the closely linked desmoglein genes on human chromosome 18.
7738346 1995 Plakoglobin binding by human Dsg3 (pemphigus vulgaris antigen) in keratinocytes requires the cadherin-like intracytoplasmic segment.
1889810 1991 Chromosomal assignment of the human genes coding for the major proteins of the desmosome junction, desmoglein DGI (DSG), desmocollins DGII/III (DSC), desmoplakins DPI/II (DSP), and plakoglobin DPIII (JUP).
1770008 1991 Structural analysis and expression of human desmoglein: a cadherin-like component of the desmosome.
1754823 [Characterization of the desmoglein in renal cells in culture].
1720352 1991 Autoantibodies against a novel epithelial cadherin in pemphigus vulgaris, a disease of cell adhesion.
1711210 1991 Desmosomal glycoprotein DGI, a component of intercellular desmosome junctions, is related to the cadherin family of cell adhesion molecules.