Property Summary

NCBI Gene PubMed Count 49
PubMed Score 275.18
PubTator Score 200.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.700 4.5e-07
esophageal adenocarcinoma -2.900 2.8e-02
posterior fossa group B ependymoma 1.600 1.1e-03
atypical teratoid / rhabdoid tumor 1.200 1.6e-02
medulloblastoma, large-cell 1.400 2.2e-02
non-small cell lung cancer 3.848 1.5e-12
interstitial cystitis -2.600 3.7e-05
breast carcinoma -1.500 4.3e-18
Breast cancer -4.000 3.2e-17
ovarian cancer -4.800 4.9e-11
cystic fibrosis and chronic rhinosinusit... 1.001 1.4e-02

Gene RIF (20)

PMID Text
26261554 Suggest that Dsc3 can mediate FSH-induced ovarian cancer cell proliferation by activating the EGFR/Akt signaling pathway.
24664224 data suggests that DNA methylation contributes to down-regulation of DSC3 in prostate cancer, and loss of DSC3 predicts poor clinical outcome.
23975055 Low expression of DSC 1, 2, and 3 was observed in 55, 54, and 79 % of liver metastases.
23184149 The data show an important role of physiologically occurring transcript d2-d4 in normal brain function. Interference with this role by DSC3 is a likely pathological mechanism in X-chromosomal dystonia parkinsonism syndrome
22941060 The p53 target gene desmocollin 3 acts as a novel tumor suppressor through inhibiting EGFR/ERK pathway in human lung cancer.
22438068 High expression of desmocollin 1 (DSC1) was observed in 41.6%, DSC2 in 58.0%, DSC3 in 61.4%, E-cadherin in 71.4%, CDX2 in 58.0%, PITX1 in 55.0%, CDK4 in 0.2%, TLE1 in 1.3%, Factor H in 42.5%, and MDM2 in 0.2% of colorectal carcinomas.
22190034 HIV-1 gp160 is identified to have a physical interaction with desmocollin 3 (DSC3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21364582 Methylation status of DSC3 DNA is a prognostic marker for colorectal cancer. P53 appears to have an important role in regulating DSC3 expression.
21281804 These findings demonstrate that IgG autoantibodies against an additional component of the desmosomes, Dsc3, induce loss of keratinocyte adhesion and thus may contribute to blister formation in pemphigus.
20952584 Autoimmunity to DSC3 in Pemphigus vulgaris.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19765682 a human desmocollin-3 (DSC3) nonsense mutation underlies hereditary hypotrichosis and recurrent skin vesicles
19717567 loss of heterophilic Dsc3/Dsg1 binding may contribute to pemphigus skin blistering
19348003 Both the binding of desmocollin 3 (Dsc3) to plakoglobin and Dsc3 phosphorylation are involved in Dsc3 binding to desmoglein 3 (Dsg3) during Ca2+ -induced desmosome assembly.
19287461 Desmocollin-3 was expressed in almost half of the undifferentiated large-cell cancers
17846785 results suggest an abnormal expression of Dsc3, Dsg3, & beta-catenin induced in the progression of oral carcinomas & that Dsc3 expression level might be related to the regulation of beta-catenin in lymph node metastasis and cell proliferation in OSCCs.
17088906 Increased Dsc3 protein is associated with colorectal cancer
16168112 Lss of DSC3 expression is a common event in primary breast tumor specimens, and DSC3 gene silencing in breast tumors is frequently linked to aberrant cytosine methylation and concomitant changes in chromatin structure.
12789271 Gene-profiling experiments of breast cancer cells infected with wt p53 revealed both MASPIN and desmocollin 3 (DSC3) to be p53-target genes, even though both genes are silenced in association with aberrant cytosine methylation of their promoters

AA Sequence

MAAAGPRRSVRGAVCLHLLLTLVIFSRAGEACKKVILNVPSKLEADKIIGRVNLEECFRSADLIRSSDPD      1 - 70
FRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRETVLRRAKRRWAPI     71 - 140
PCSMQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTGNLFCTRPVDREEYDVFD    141 - 210
LIAYASTADGYSADLPLPLPIRVEDENDNHPVFTEAIYNFEVLESSRPGTTVGVVCATDRDEPDTMHTRL    211 - 280
KYSILQQTPRSPGLFSVHPSTGVITTVSHYLDREVVDKYSLIMKVQDMDGQFFGLIGTSTCIITVTDSND    281 - 350
NAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINTANWRVNFTILKGNENGHFKISTDKETNEGVLSVV    351 - 420
KPLNYEENRQVNLEIGVNNEAPFARDIPRVTALNRALVTVHVRDLDEGPECTPAAQYVRIKENLAVGSKI    421 - 490
NGYKAYDPENRNGNGLRYKKLHDPKGWITIDEISGSIITSKILDREVETPKNELYNITVLAIDKDDRSCT    491 - 560
GTLAVNIEDVNDNPPEILQEYVVICKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVND    561 - 630
TAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRSTGVILGKWAILAILLGI    631 - 700
ALLFSVLLTLVCGVFGATKGKRFPEDLAQQNLIISNTEAPGDDRVCSANGFMTQTTNNSSQGFCGTMGSG    701 - 770
MKNGGQETIEMMKGGNQTLESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKLHRCNQNE    771 - 840
DRMPSQDYVLTYNYEGRGSPAGSVGCCSEKQEEDGLDFLNNLEPKFITLAEACTKR                  841 - 896
//

Text Mined References (50)

PMID Year Title
26261554 2015 Desmocollin 3 mediates follicle stimulating hormone-induced ovarian epithelial cancer cell proliferation by activating the EGFR/Akt signaling pathway.
24664224 2014 Association of DSC3 mRNA down-regulation in prostate cancer with promoter hypermethylation and poor prognosis.
24221342 2014 Large cell carcinoma of the lung: clinically oriented classification integrating immunohistochemistry and molecular biology.
23975055 2014 The influence of desmocollin 1-3 expression on prognosis after curative resection of colorectal liver metastases.
23946009 2013 Two cases of pemphigus vegetans with IgG anti-desmocollin 3 antibodies.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23517469 2013 IgA pemphigus with paraneoplastic pemphigus-like clinical features showing IgA antibodies to desmoglein 1/3 and desmocollin 3, and IgG and IgA antibodies to the basement membrane zone.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23184149 2013 X-linked dystonia parkinsonism syndrome (XDP, lubag): disease-specific sequence change DSC3 in TAF1/DYT3 affects genes in vesicular transport and dopamine metabolism.
23060301 2013 Expression of squamous cell carcinoma markers and adenocarcinoma markers in primary pulmonary neuroendocrine carcinomas.
22941060 2012 The p53 target gene desmocollin 3 acts as a novel tumor suppressor through inhibiting EGFR/ERK pathway in human lung cancer.
22735276 Atypical pemphigus with exclusively anti-desmocollin 3-specific IgG antibodies.
22438068 2012 Loss of desmocollin 1-3 and homeobox genes PITX1 and CDX2 are associated with tumor progression and survival in colorectal carcinoma.
21929534 2012 Desmosomal genodermatoses.
21623236 2011 Utility of 10 immunohistochemical markers including novel markers (desmocollin-3, glypican 3, S100A2, S100A7, and Sox-2) for differential diagnosis of squamous cell carcinoma from adenocarcinoma of the Lung.
21559267 2011 Human Chondrosarcoma Cells Acquire an Epithelial-Like Gene Expression Pattern via an Epigenetic Switch: Evidence for Mesenchymal-Epithelial Transition during Sarcomagenesis.
21364582 2011 DSC3 expression is regulated by p53, and methylation of DSC3 DNA is a prognostic marker in human colorectal cancer.
21281804 2011 IgG autoantibodies against desmocollin 3 in pemphigus sera induce loss of keratinocyte adhesion.
20952584 2010 Autoimmunity to desmocollin 3 in pemphigus vulgaris.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19765682 2009 A homozygous nonsense mutation in the human desmocollin-3 (DSC3) gene underlies hereditary hypotrichosis and recurrent skin vesicles.
19717567 2009 Desmocollin 3-mediated binding is crucial for keratinocyte cohesion and is impaired in pemphigus.
19348003 2009 Low to high Ca2+ -switch causes phosphorylation and association of desmocollin 3 with plakoglobin and desmoglein 3 in cultured keratinocytes.
19287461 2009 Desmocollin-3: a new marker of squamous differentiation in undifferentiated large-cell carcinoma of the lung.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17846785 2007 Altered expression of desmocollin 3, desmoglein 3, and beta-catenin in oral squamous cell carcinoma: correlation with lymph node metastasis and cell proliferation.
17088906 2006 Desmocollin switching in colorectal cancer.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16168112 2005 Epigenetic silencing of DSC3 is a common event in human breast cancer.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12789271 2003 Mutant p53 and aberrant cytosine methylation cooperate to silence gene expression.
12707304 2003 Defining desmosomal plakophilin-3 interactions.
12615965 2003 Targeting of p0071 to desmosomes and adherens junctions is mediated by different protein domains.
11500511 2001 The fate of desmosomal proteins in apoptotic cells.
11408939 2001 Down-regulation of the desmosomal cadherin desmocollin 3 in human breast cancer.
11181078 2001 The regulatory region of the human desmocollin 3 promoter forms a DNA four-way junction.
11027496 2000 Genomic organization and amplification of the human desmosomal cadherin genes DSC1 and DSC3, encoding desmocollin types 1 and 3.
10769211 2000 Different effects of dominant negative mutants of desmocollin and desmoglein on the cell-cell adhesion of keratinocytes.
10482015 Diversity of desmosomal proteins in regenerating epidermis: immunohistochemical study using a human skin organ culture model.
9810708 1998 Compositionally different desmosomes in the various compartments of the human hair follicle.
8884173 1996 Patterns of desmocollin synthesis in human epithelia: immunolocalization of desmocollins 1 and 3 in special epithelia and in cultured cells.
8486729 1993 Nomenclature of the desmosomal cadherins.
7983064 1994 Posttranslational regulation of plakoglobin expression. Influence of the desmosomal cadherins on plakoglobin metabolic stability.
7959727 1994 Mouse desmocollin (Dsc3) and desmoglein (Dsg1) genes are closely linked in the proximal region of chromosome 18.
7929347 1994 cDNA cloning and expression of a novel human desmocollin.
7774948 1995 Assignment of the human genes for desmocollin 3 (DSC3) and desmocollin 4 (DSC4) to chromosome 18q12.
7665906 1995 The desmocollins of human foreskin epidermis: identification and chromosomal assignment of a third gene and expression patterns of the three isoforms.
1889810 1991 Chromosomal assignment of the human genes coding for the major proteins of the desmosome junction, desmoglein DGI (DSG), desmocollins DGII/III (DSC), desmoplakins DPI/II (DSP), and plakoglobin DPIII (JUP).