Property Summary

NCBI Gene PubMed Count 109
PubMed Score 289.56
PubTator Score 326.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.151 4.3e-03
intraductal papillary-mucinous neoplasm ... 1.100 7.0e-03
group 3 medulloblastoma 1.100 6.0e-04
ovarian cancer 1.400 2.0e-03
dermatomyositis 1.500 9.9e-05

Gene RIF (92)

PMID Text
26976605 An essential role of DROSHA in the canonical miRNA pathway
26921501 we found that both the structural features of shmiR hairpins and the nucleotide sequence at Drosha and Dicer processing sites contribute to cleavage site selection and cleavage precision.
26748718 Study reports the X-ray structure of DROSHA in complex with the C-terminal helix of DGCR8; DROSHA contains two DGCR8-binding sites, one on each RNase III domain (RIIID), which mediate the assembly of Microprocessor; overall structure of DROSHA is surprisingly similar to that of Dicer despite no sequence homology apart from the C-terminal part.
26694172 Gradual loss of cytoplasmic Drosha was accompanied by tumor progression in both gastric cancer tissues and cell lines, and was inversely associated with tumor volume (P = 0.002), tumor grade (P < 0.001), tumor stage (P = 0.018), and distant metastasis
26683315 DGCR8 and Drosha assemble into a heterotrimeric complex on RNA, comprising two DGCR8 molecules and one Drosha molecule.
26522361 Drosha expression was reduced gradually with the degrading histological differentiation of gastric adenocarcinoma, and the knock-down of Drosha expression could promote gastric adenocarcinoma cell invasion.
26227789 Results indicate the role of Drosha, Dicer and Ago2 proteins in the development of non-small cell lung carcinomas (NSCLC) and suggest that Dicer may be implicated in the progression of these tumors to advanced stages.
26156018 DICER1 and DROSHA copy number variation may be an important mechanism of upregulation/downregulation of miRNAs in lung cancer
26147304 Variations in DROSHA rs10719 of Korean patients are significantly associated with their risk of colorectal cancer.
26027739 Together with a 23-amino acid peptide from DGCR8, DROSHA constitutes a minimal functional core. DROSHA serves as a "ruler" by measuring 11 bp from the basal ssRNA-dsRNA junction. DGCR8 interacts with the stem and apical elements through its dsRNA-binding domains and RNA-binding heme domain, respectively, allowing efficient and accurate processing.
25867481 The sequence and structural features of Drosha and Dicer cleavage sites.
25756586 Drosha protein was identified as a new component of dipeptide-repeat aggregates in frontotemporal lobar degeneration and tauopathy.
25699712 p38 MAPK directly phosphorylates Drosha at its N terminus promoting its nuclear export and degradation.
25670083 Recurrent mutations included a hotspot mutation (Q177R) in the homeo-domain of SIX1 and SIX2 in tumors with high proliferative potential (18.1% of blastemal cases); mutations in the DROSHA/DGCR8 microprocessor genes
25670082 in tumors with DGCR8 E518K and DROSHA exon 29 (miRNAPG-HS) mutations ... greater prevalence of tumors with blastemal predominant histology in patients with miRNAPG-HS and/or SIX1/2 Q177R mutations
25656609 EIF2C2, Dicer, and Drosha are more highly expressed in bladder carcinoma, promote the development of bladder cancer, and suggested a poor prognosis
25439752 We aimed to evaluate the expression of the major components of microRNA biogenesis machinery including Drosha, Dicer and DiGeorge syndrome critical region gene 8 (DGCR8) in multiple sclerosis patients
25295740 Drosha is upregulated in gestational diabetes.
25190313 DROSHA RNase IIIB mutations globally inhibit miRNA biogenesis through a dominant-negative mechanism in Wilms tumors.
25058539 To inhibit the expression of Drosha.
24938790 Knockdown of Drosha by shRNA leads to inhibit enrichment of HIV-1 Gag in intracellular vacuoles, but enhance viral particle release in Gag expressing cells
24909689 The involvement of E2F1-dependent DROSHA activation in pri-miRNA processing under DNA damage stress will provide further insight into the regulation of miRNA biosynthesis.
24909261 data underscore the pivotal role of the miRNA biogenesis pathway in WT tumorigenesis, particularly the major miRNA-processing gene DROSHA
24854622 The pri-miRNA stem, defined by internal and flanking structural elements, guides the binding position of Drosha-DGCR8, which consequently determines the cleavage site.
24786770 conclude that Drosha can function like a splicing enhancer and promote exon inclusion. Our results reveal a new mechanism of alternative splicing regulation involving a cleavage-independent role for Drosha in splicing
24769857 Association between recurrent pregnancy loss development and the polymorphism of the miRNA machinery gene RAN and combined genotype of DROSHA/DICER.
24725360 The altered expression of Dicer and Drosha may serve as markers for disrupted miRNA biogenesis in Triple negative breast cancer
24677349 Change in Drosha expression can be a biologically relevant mechanism by which eukaryotic cells control miRNA profiles
24589731 The Microprocessor complex of Drosha and DGCR8 proteins, which is responsible for the processing of the primary transcripts during the generation of microRNAs, destabilizes the mRNA of Aurora kinase B.
24574065 Low Drosha expression is associated with invasive breast carcinoma.
24360955 Drosha regulates nascent gene transcription trhough interaction with CBP80 and RNA PolII.
24312312 DROSHA rs10719T>C polymorphism may be associated with bladder cancer risk in a Chinese population, and hsa-miR-27b can influence the expression of DROSHA protein by binding with 3'UTR
24297910 If the distances are not optimal, Drosha tends to cleave at multiple sites, which can, in turn, generate multiple 5' isomiRs.
24009686 Acetylation of Drosha on those N-terminal lysine sites prevents Drosha ubiquitination, thereby preventing its degradation.
23995758 Ectopic AKAP95 stimulates expression of a chromosomal reporter gene in synergy with MLL1 or MLL2, whereas AKAP95 depletion impairs retinoic acid-mediated gene induction in embryonic stem cells
23974981 results indicate a block of miRNA maturation at the DROSHA processing step
23969986 Our results suggest that Drosha affects the biological activity of cervical cancer cells by regulating the expression of numerous tumour-associated proteins.
23863141 RNase III enzyme Drosha and the double-stranded RNA-binding protein DGCR8 binds and regulates a large variety of cellular RNAs
23663110 It is a miRNA processing enzyme and altered in non-alcoholic fatty liver disease.
23370771 Our results demonstrate a reduced nuclear expression of DROSHA in melanoma
23349018 Levels of DICER1, DROSHA and five different miRNAs were measured in NSCLC specimens.
23305493 Primary microRNA structure reveals deviations from canonical double-stranded RNA structure in the stem adjacent to the Drosha cut site. The necessity of these deformable sites for efficient processing is demonstrated through Drosha processing assays.
23272639 miRNA regulatory effect is a heritable trait in humans; a polymorphism of the DROSHA gene contributes to the observed inter-individual differences.
23266047 Data indicate that tumour sample showed a significantly higher Drosha expression versus normal mucosa, while Dicer levels did not differ.
23225145 Drosha protein potentially plays an important role in breast cancer progression.
22935707 A subset of Lin28 mRNA targets are destabilized in a Drosha-dependent manner.
22796965 DGCR8-mediated cleavage of snoRNAs was independent of Drosha, suggesting the involvement of DGCR8 in cellular complexes with other endonucleases. Binding of DGCR8 to cassette exons is a new mechanism for regulation of alternatively spliced isoforms.
22766726 Dicer, Drosha, and Exportin 5 genes were up-regulated in bladder urothelial carcinoma compared to normal urothelium. Silencing these genes induced cell proliferation inhibition and apoptosis in bladder urothelial carcinoma cells.
22647351 Drosha, Dicer, Argonaute 1, and Argonaute 2 are differentially expressed at different metastatic sites in ovarian carcinoma compared with primary carcinomas.
22554933 Gene silencing of hepatitis B virus X protein by RNA interference significantly restored the expression of Drosha.
22496623 Rare Drosha splice variants are deficient in microRNA processing but do not affect general microRNA expression in cancer cells
22479364 Data show that down-regulation of either Dicer or Drosha had no effect on the sensitivity of cells to irradiation.
22394132 results provide novel evidence that Drosha, is probably involved in the pathobiology of human smooth muscle neoplasms
22393237 DGCR8 and Drosha are targeted post-transcriptionally to chromosome 19 microRNA cluster pri-miRNAs as a preformed complex but dissociate separately.
22381205 The results showed that genetic variants of DROSHA may modify the risk of abnormal semen parameters, which could result in male infertility.
22371183 mesenchymal stromal cells from MDS patients show low gene and protein expression of DICER1 and DROSHA which are involved in the microRNA biogenesis, as well as their target gene SBDS.
22162762 PTEN-mediated miR-21 regulation is achieved by inhibiting the interaction between the Drosha complex and RNH1, revealing previously unidentified role of PTEN in the oncogenic miR-21 biogenesis
21953080 Drosha and Dicer expression was dysregulation in nasopharyngeal carcinoma compared with healthy control samples.
21898071 Low drosha expression is associated with breast cancer.
21794839 Drosha regulates human mesenchymal stem cells cell cycle progression through a miRNA independent mechanism, potentially by regulating rRNA processing.
21769619 Our results suggest that Drosha, Dicer, and Ago2 are possibly implicated in colorectal carcinoma pathobiology
21697496 The authors report that Drosha cleavage of latency III BHRF1 RNA and cis-acting splicing effects inhibit splicing and inhibit BHRF1 RNA and protein expression.
21690333 Drosha, an endoribonuclease best known for its role in the biogenesis of microRNAs, can also function to directly regulate viral gene expression of Kaposi's sarcoma-associated herpesvirus
21683814 the selectivity of Drosha action contributes greatly to the specificity and efficiency of miRNA biogenesis
21559780 This study revealed for the first time that expression alterations of Dicer and Drosha are present in endometrial cancer tissue and could be potentially responsible for altered microRNAs profiles observed in this malignancy.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20805302 Findings of growth promotion by Drosher silencing implies its potential use as therapeutic targets for neuroblastoma.
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20721975 Observational study of gene-disease association. (HuGE Navigator)
20705240 Smad proteins bind a conserved RNA sequence to promote microRNA maturation by Drosha.
20585341 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20211803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20210522 Report dysregulation of microRNA processing enzymes Drosha and Dicer in epithelial skin tumors when compared to healthy control samples.
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19759829 a Microprocessor, containing the RNA binding protein Dgcr8 and RNase III enzyme Drosha, is responsible for processing primary microRNAs to precursor microRNAs
19721432 The mRNA for microprocessor component DROSHA was found to be significantly upregulated in the dorsolateral prefrontal cortex in tissues from schizophrenic patients.
19138993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19135890 The Drosha-DGCR8 complex cleaves the hairpin in the DGCR8 mRNA and thus destabilizes the mRNA; DGCR8 stabilizes Drosha protein via protein interaction; this crossregulation between Drosha and DGCR8 may contribute to the control of miRNA biogenesis.
19092150 Our findings indicate that levels of Dicer and Drosha mRNA in ovarian-cancer cells have associations with outcomes in patients with ovarian cancer.
19047128 Observational study of gene-disease association. (HuGE Navigator)
18559093 Integrative genomics analysis of chromosome 5p gain in cervical cancer reveals target over-expressed genes, including Drosha.
17626073 miR-BHRF1-2 in 3' cleavage of BHRF1 mRNA in the cytoplasm and Drosha in cleavage of latency III EBNA and EBV replication-associated BHRF1 transcripts in the nucleus.
17581865 identify specific miRNAs up-regulated in leukemias triggered by All1 fusions. All1 fusion protein-mediated recruitment of Drosha to target genes encoding miRNAs is demonstrated
17255951 Drosha may cleave intronic miRNAs between the splicing commitment step and the excision step, thereby ensuring both miRNA biogenesis and protein synthesis from a single primary transcript.
17121874 We found that RNASEN expression levels were enhanced in a fraction of esophageal cancers.
15987463 Dicer gene expression in human breast cells is regulated by alternative promoter selection to alter the length and composition of the 5'-leader sequence of its mRNA
15932881 processing of primary microRNA hairpins by Drosha requires flanking nonstructured RNA sequences
15574589 nuclear RNase III Drosha cleaves primary miRNAs (pri-miRNAs) to release hairpin-shaped pre-miRNAs that are subsequently cut by the cytoplasmic RNase III Dicer to generate mature miRNAs
15565168 Data show that human Drosha selectively cleaves RNA hairpins bearing a large (>/=10 nucleotides) terminal loop.
15531877 human Drosha is a component of two multi-protein complexes; both components of the smaller complex, termed Microprocessor, are necessary and sufficient in mediating the genesis of miRNAs from the primary miRNA transcript
14508493 identification of another RNase III, human Drosha, as the core nuclease that executes the initiation step of miRNA processing in the nucleus

AA Sequence

MMQGNTCHRMSFHPGRGCPRGRGGHGARPSAPSFRPQNLRLLHPQQPPVQYQYEPPSAPSTTFSNSPAPN      1 - 70
FLPPRPDFVPFPPPMPPSAQGPLPPCPIRPPFPNHQMRHPFPVPPCFPPMPPPMPCPNNPPVPGAPPGQG     71 - 140
TFPFMMPPPSMPHPPPPPVMPQQVNYQYPPGYSHHNFPPPSFNSFQNNPSSFLPSANNSSSPHFRHLPPY    141 - 210
PLPKAPSERRSPERLKHYDDHRHRDHSHGRGERHRSLDRRERGRSPDRRRQDSRYRSDYDRGRTPSRHRS    211 - 280
YERSRERERERHRHRDNRRSPSLERSYKKEYKRSGRSYGLSVVPEPAGCTPELPGEIIKNTDSWAPPLEI    281 - 350
VNHRSPSREKKRARWEEEKDRWSDNQSSGKDKNYTSIKEKEPEETMPDKNEEEEEELLKPVWIRCTHSEN    351 - 420
YYSSDPMDQVGDSTVVGTSRLRDLYDKFEEELGSRQEKAKAARPPWEPPKTKLDEDLESSSESECESDED    421 - 490
STCSSSSDSEVFDVIAEIKRKKAHPDRLHDELWYNDPGQMNDGPLCKCSAKARRTGIRHSIYPGEEAIKP    491 - 560
CRPMTNNAGRLFHYRITVSPPTNFLTDRPTVIEYDDHEYIFEGFSMFAHAPLTNIPLCKVIRFNIDYTIH    561 - 630
FIEEMMPENFCVKGLELFSLFLFRDILELYDWNLKGPLFEDSPPCCPRFHFMPRFVRFLPDGGKEVLSMH    631 - 700
QILLYLLRCSKALVPEEEIANMLQWEELEWQKYAEECKGMIVTNPGTKPSSVRIDQLDREQFNPDVITFP    701 - 770
IIVHFGIRPAQLSYAGDPQYQKLWKSYVKLRHLLANSPKVKQTDKQKLAQREEALQKIRQKNTMRREVTV    771 - 840
ELSSQGFWKTGIRSDVCQHAMMLPVLTHHIRYHQCLMHLDKLIGYTFQDRCLLQLAMTHPSHHLNFGMNP    841 - 910
DHARNSLSNCGIRQPKYGDRKVHHMHMRKKGINTLINIMSRLGQDDPTPSRINHNERLEFLGDAVVEFLT    911 - 980
SVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHGPDLCRESDLRHAMANCFEALIGA    981 - 1050
VYLEGSLEEAKQLFGRLLFNDPDLREVWLNYPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTH   1051 - 1120
VRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKV   1121 - 1190
AEELGMQEYAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQDWND   1191 - 1260
PKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQAEMGAAMDALE   1261 - 1330
KYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIKK                             1331 - 1374
//

Text Mined References (120)

PMID Year Title
26976605 2016 Re-evaluation of the roles of DROSHA, Export in 5, and DICER in microRNA biogenesis.
26921501 2016 siRNA release from pri-miRNA scaffolds is controlled by the sequence and structure of RNA.
26748718 2016 Structure of Human DROSHA.
26694172 2016 Cytoplasmic Drosha Is Aberrant in Precancerous Lesions of Gastric Carcinoma and Its Loss Predicts Worse Outcome for Gastric Cancer Patients.
26683315 2016 A heterotrimer model of the complete Microprocessor complex revealed by single-molecule subunit counting.
26522361 2015 [A negative correlation between Drosha expression and gastric adenocarcinoma malignancy and invasion].
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26227789 2015 Expression of the microRNA regulators Drosha, Dicer and Ago2 in non-small cell lung carcinomas.
26156018 2015 High copy number variation of cancer-related microRNA genes and frequent amplification of DICER1 and DROSHA in lung cancer.
26147304 2015 3'-UTR Polymorphisms in the MiRNA Machinery Genes DROSHA, DICER1, RAN, and XPO5 Are Associated with Colorectal Cancer Risk in a Korean Population.
26027739 2015 Functional Anatomy of the Human Microprocessor.
25867481 2015 Sequence features of Drosha and Dicer cleavage sites affect the complexity of isomiRs.
25756586 2015 Drosha inclusions are new components of dipeptide-repeat protein aggregates in FTLD-TDP and ALS C9orf72 expansion cases.
25699712 2015 Stress induces p38 MAPK-mediated phosphorylation and inhibition of Drosha-dependent cell survival.
25670083 2015 Mutations in the SIX1/2 pathway and the DROSHA/DGCR8 miRNA microprocessor complex underlie high-risk blastemal type Wilms tumors.
25670082 2015 Recurrent DGCR8, DROSHA, and SIX homeodomain mutations in favorable histology Wilms tumors.
25656609 2015 EIF2C, Dicer, and Drosha are up-regulated along tumor progression and associated with poor prognosis in bladder carcinoma.
25439752 2015 Overexpression of microRNA biogenesis machinery: Drosha, DGCR8 and Dicer in multiple sclerosis patients.
25295740 2015 Upregulation of microRNA processing enzymes Drosha and Dicer in gestational diabetes mellitus.
25190313 2014 Somatic mutations in DROSHA and DICER1 impair microRNA biogenesis through distinct mechanisms in Wilms tumours.
25058539 2014 Knockdown of Drosha in human alveolar type II cells alters expression of SP-A in culture: a pilot study.
24909689 2014 E2F1-regulated DROSHA promotes miR-630 biosynthesis in cisplatin-exposed cancer cells.
24909261 2014 Recurrent somatic mutation in DROSHA induces microRNA profile changes in Wilms tumour.
24854622 2014 A central role for the primary microRNA stem in guiding the position and efficiency of Drosha processing of a viral pri-miRNA.
24786770 2014 Drosha promotes splicing of a pre-microRNA-like alternative exon.
24769857 2014 Genetic variants in microRNA machinery genes are associated [corrected] with idiopathic recurrent pregnancy loss risk.
24725360 2014 The expression of Dicer and Drosha in matched normal tissues, tumours and lymph node metastases in triple negative breast cancer.
24677349 2014 miRNA sensitivity to Drosha levels correlates with pre-miRNA secondary structure.
24589731 2014 Cell cycle-dependent regulation of Aurora kinase B mRNA by the Microprocessor complex.
24581491 2014 Hippo signaling regulates microprocessor and links cell-density-dependent miRNA biogenesis to cancer.
24574065 2014 Complexity in regulation of microRNA machinery components in invasive breast carcinoma.
24360955 2013 Drosha regulates gene expression independently of RNA cleavage function.
24312312 2013 Genetic variation in DROSHA 3'UTR regulated by hsa-miR-27b is associated with bladder cancer risk.
24297910 2013 Lower and upper stem-single-stranded RNA junctions together determine the Drosha cleavage site.
24009686 2013 Acetylation of drosha on the N-terminus inhibits its degradation by ubiquitination.
23995758 2013 The Microprocessor controls the activity of mammalian retrotransposons.
23974981 2014 Defective DROSHA processing contributes to downregulation of MiR-15/-16 in chronic lymphocytic leukemia.
23969986 2013 Proteomic identification of target proteins following Drosha knockdown in cervical cancer.
23863141 2013 Cellular functions of the microprocessor.
23663110 2013 Expression of genes for microRNA-processing enzymes is altered in advanced non-alcoholic fatty liver disease.
23370771 2013 Expression of the RNase III enzyme DROSHA is reduced during progression of human cutaneous melanoma.
23349018 2013 DICER1, DROSHA and miRNAs in patients with non-small cell lung cancer: implications for outcomes and histologic classification.
23305493 2013 Ensemble analysis of primary microRNA structure reveals an extensive capacity to deform near the Drosha cleavage site.
23272639 2012 The regulatory effect of miRNAs is a heritable genetic trait in humans.
23266047 2013 Dicer and Drosha expression and response to Bevacizumab-based therapy in advanced colorectal cancer patients.
23232809 2012 FUS stimulates microRNA biogenesis by facilitating co-transcriptional Drosha recruitment.
23225145 2013 The microRNA maturation regulator Drosha is an independent predictor of outcome in breast cancer patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22935707 2012 Drosha mediates destabilization of Lin28 mRNA targets.
22796965 2012 DGCR8 HITS-CLIP reveals novel functions for the Microprocessor.
22766726 2013 Inducing cell proliferation inhibition and apoptosis via silencing Dicer, Drosha, and Exportin 5 in urothelial carcinoma of the bladder.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22647351 2012 Argonaute, Dicer, and Drosha are up-regulated along tumor progression in serous ovarian carcinoma.
22554933 2012 Correlation between hepatitis B virus protein and microRNA processor Drosha in cells expressing HBV.
22496623 2012 Rare Drosha splice variants are deficient in microRNA processing but do not affect general microRNA expression in cancer cells.
22479364 2012 Knock-down of core proteins regulating microRNA biogenesis has no effect on sensitivity of lung cancer cells to ionizing radiation.
22394132 2012 Immunohistochemical analysis of the endoribonucleases Drosha, Dicer and Ago2 in smooth muscle tumours of soft tissues.
22393237 2012 Microprocessor dynamics and interactions at endogenous imprinted C19MC microRNA genes.
22381205 2012 Genetic variants in microRNA biogenesis pathway genes are associated with semen quality in a Han-Chinese population.
22371183 2012 Impaired expression of DICER, DROSHA, SBDS and some microRNAs in mesenchymal stromal cells from myelodysplastic syndrome patients.
22222205 2012 Histone deacetylase 1 enhances microRNA processing via deacetylation of DGCR8.
22162762 2011 PTEN modulates miR-21 processing via RNA-regulatory protein RNH1.
22118463 2011 Lin28A and Lin28B inhibit let-7 microRNA biogenesis by distinct mechanisms.
21953080 2012 The microRNA-processing enzymes: Drosha and Dicer can predict prognosis of nasopharyngeal carcinoma.
21898071 2012 Dysregulated expression of dicer and drosha in breast cancer.
21794839 2011 Drosha regulates hMSCs cell cycle progression through a miRNA independent mechanism.
21769619 2011 Expression of the ribonucleases Drosha, Dicer, and Ago2 in colorectal carcinomas.
21697496 2011 cis-Acting effects on RNA processing and Drosha cleavage prevent Epstein-Barr virus latency III BHRF1 expression.
21690333 2011 Expanding the role of Drosha to the regulation of viral gene expression.
21683814 Drosha processing controls the specificity and efficiency of global microRNA expression.
21559780 2011 Major regulators of microRNAs biogenesis Dicer and Drosha are down-regulated in endometrial cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20805302 2010 microRNA signature and expression of Dicer and Drosha can predict prognosis and delineate risk groups in neuroblastoma.
20732906 2010 Genetic variations in microRNA-related genes are associated with survival and recurrence in patients with renal cell carcinoma.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20705240 2010 Smad proteins bind a conserved RNA sequence to promote microRNA maturation by Drosha.
20585341 2011 Role of primary miRNA polymorphic variants in metastatic colon cancer patients treated with 5-fluorouracil and irinotecan.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20226070 2010 Solution structure of the Drosha double-stranded RNA-binding domain.
20211803 2010 Black carbon exposures, blood pressure, and interactions with single nucleotide polymorphisms in MicroRNA processing genes.
20210522 2010 Expression levels of the microRNA processing enzymes Drosha and dicer in epithelial skin cancer.
20180804 2010 Comparison of human RNase 3 and RNase 7 bactericidal action at the Gram-negative and Gram-positive bacterial cell wall.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
19759829 2009 Genomic analysis suggests that mRNA destabilization by the microprocessor is specialized for the auto-regulation of Dgcr8.
19721432 2010 Schizophrenia is associated with an increase in cortical microRNA biogenesis.
19138993 2008 Genetic variations in microRNA-related genes are novel susceptibility loci for esophageal cancer risk.
19135890 2009 Posttranscriptional crossregulation between Drosha and DGCR8.
19092150 2008 Dicer, Drosha, and outcomes in patients with ovarian cancer.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
18632581 2008 The FHA domain proteins DAWDLE in Arabidopsis and SNIP1 in humans act in small RNA biogenesis.
18559093 2008 Integrative genomics analysis of chromosome 5p gain in cervical cancer reveals target over-expressed genes, including Drosha.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17626073 2007 Epstein-Barr virus BHRF1 micro- and stable RNAs during latency III and after induction of replication.
17581865 2007 Oncogenic All1 fusion proteins target Drosha-mediated microRNA processing.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17255951 2007 Processing of intronic microRNAs.
17159994 2007 Heme is involved in microRNA processing.
17121874 2006 RNASEN regulates cell proliferation and affects survival in esophageal cancer patients.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16906129 2006 Formation of GW bodies is a consequence of microRNA genesis.
16751099 2006 Molecular basis for the recognition of primary microRNAs by the Drosha-DGCR8 complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15987463 2005 Alternative initiation and splicing in dicer gene expression in human breast cells.
15932881 2005 Efficient processing of primary microRNA hairpins by Drosha requires flanking nonstructured RNA sequences.
15589161 2004 The human DiGeorge syndrome critical region gene 8 and Its D. melanogaster homolog are required for miRNA biogenesis.
15574589 2004 The Drosha-DGCR8 complex in primary microRNA processing.
15565168 2005 Recognition and cleavage of primary microRNA precursors by the nuclear processing enzyme Drosha.
15531877 2004 The Microprocessor complex mediates the genesis of microRNAs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14508493 2003 The nuclear RNase III Drosha initiates microRNA processing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12191433 2002 Mouse ribonuclease III. cDNA structure, expression analysis, and chromosomal location.
10976766 2000 A set of proteins interacting with transcription factor Sp1 identified in a two-hybrid screening.
10948199 2000 Human RNase III is a 160-kDa protein involved in preribosomal RNA processing.
10713462 2000 A novel type of RNase III family proteins in eukaryotes.