Property Summary

NCBI Gene PubMed Count 3
PubMed Score 22.75
PubTator Score 7.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

AA Sequence

MFYFHCPPQLEGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKI      1 - 70
NLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQARSKKEALEAQQSLG     71 - 140
RTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLCSCCVPDPMGLSFLPTYGCQSNRTASVATLR    141 - 210
MKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV                     211 - 263
//

Text Mined References (4)

PMID Year Title