Property Summary

NCBI Gene PubMed Count 24
PubMed Score 2.36
PubTator Score 19.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 5.4e-04
ovarian cancer 8491 6.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 5.4e-04
ovarian cancer 1.300 6.3e-04

Gene RIF (7)

PMID Text
25993655 DRG-1 plays an important role in melanoma cell growth and transformation, indicating that DRG1 may represent a novel target for CD4(+) T cell-mediated immunotherapy in melanoma.
23711155 Lerepo4 action leaves Drg1 affinity for nucleotides unaffected, feasibly favoring a switch I reorientation, mainly via the TGS domain.
23125841 Tandem affinity purification and mass spectrometry analysis identify developmentally regulated GTP binding protein 1 (DRG1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19058789 Observational study of gene-disease association. (HuGE Navigator)
17178897 The tumor metastasis suppressor gene Drg-1 suppresses metastasis of prostate tumor cells by inhibiting the invasive ability of the cells via down-regulation of the expression of the ATF3 gene.
15184886 our results strongly suggest functional involvement of the Drg-1 gene in suppressing the metastatic advancement of human breast cancer.
12702552 Drg-1 is a candidate metastasis suppressor gene for prostate cancer and may serve as a useful prognostic marker.

AA Sequence

MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFV      1 - 70
GFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVAR     71 - 140
TCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILA    141 - 210
EYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDD    211 - 280
LLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKV    281 - 350
GKDHTLEDEDVIQIVKK                                                         351 - 367
//

Text Mined References (30)

PMID Year Title
25993655 2015 Identification of DRG-1 As a Melanoma-Associated Antigen Recognized by CD4+ Th1 Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944354 2015 Host interactions of Chandipura virus matrix protein.
25416956 2014 A proteome-scale map of the human interactome network.
23711155 2013 Human Drg1 is a potassium-dependent GTPase enhanced by Lerepo4.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19819225 2009 Independent stabilizations of polysomal Drg1/Dfrp1 complex and non-polysomal Drg2/Dfrp2 complex in mammalian cells.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18184589 2008 Structure of the human protein kinase MPSK1 reveals an atypical activation loop architecture.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17709345 2007 Ubc9 fusion-directed SUMOylation identifies constitutive and inducible SUMOylation.
17178897 2006 The tumor metastasis suppressor gene Drg-1 down-regulates the expression of activating transcription factor 3 in prostate cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15676025 2005 Identification of DRG family regulatory proteins (DFRPs): specific regulation of DRG1 and DRG2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15184886 2004 Role of the putative tumor metastasis suppressor gene Drg-1 in breast cancer progression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12702552 2003 The Drg-1 gene suppresses tumor metastasis in prostate cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10760581 2000 DRG represents a family of two closely related GTP-binding proteins.
10591208 1999 The DNA sequence of human chromosome 22.
9824680 1998 SCL binds the human homologue of DRG in vivo.
8649774 1996 Association of a novel GTP binding protein, DRG, with TAL oncogenic proteins.
7929244 1994 A novel GTP-binding protein which is selectively repressed in SV40 transformed fibroblasts.
1449490 1992 DRG: a novel developmentally regulated GTP-binding protein.
1280421 1992 Expression of DRG during murine embryonic development.