Property Summary

Ligand Count 120
NCBI Gene PubMed Count 111
PubMed Score 183.67
PubTator Score 136.59

Knowledge Summary

Patent (4,072)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.8e-03
gastric carcinoma -2.400 3.0e-02

Gene RIF (92)

AA Sequence

MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRH      1 - 70
LRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYW     71 - 140
AISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEP    141 - 210
DVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAP    211 - 280
DTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWA    281 - 350
NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP    351 - 420
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH                 421 - 477
//

Text Mined References (112)

PMID Year Title