Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.47
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.1e-02
chronic rhinosinusitis -1.665 4.9e-02
ependymoma 2.800 8.1e-11
group 3 medulloblastoma 1.400 7.1e-04
lung adenocarcinoma -1.100 2.2e-07
nasopharyngeal carcinoma -1.800 1.6e-05

Gene RIF (1)

AA Sequence

MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKL      1 - 70
QLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGN     71 - 140
NRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSID    141 - 210
ELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKF    211 - 280
VIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKM    281 - 350
ILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEIS    351 - 420
ISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRIHKD    421 - 490
EIMRNRKRVKEINQYIDHMQSELDNLECGDILD                                         491 - 523
//

Text Mined References (15)

PMID Year Title