Property Summary

NCBI Gene PubMed Count 12
PubMed Score 16.81
PubTator Score 4.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.600 1.2e-03
Astrocytoma, Pilocytic 2.200 7.6e-05
atypical teratoid / rhabdoid tumor 1.800 1.3e-02
ependymoma 3.200 2.4e-09
glioblastoma 2.100 2.9e-06
group 3 medulloblastoma 5.800 4.2e-10
medulloblastoma, large-cell 2.600 1.9e-03
primitive neuroectodermal tumor 3.300 1.1e-03

Gene RIF (2)

AA Sequence

MAGPAIHTAPMLFLVLLLPLELSLAGALAPGTPARNLPENHIDLPGPALWTPQASHHRRRGPGKKEWGPG      1 - 70
LPSQAQDGAVVTATRQASRLPEAEGLLPEQSPAGLLQDKDLLLGLALPYPEKENRPPGWERTRKRSREHK     71 - 140
RRRDRLRLHQGRALVRGPSSLMKKAELSEAQVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTS    141 - 210
LRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDC    211 - 280
LPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV     281 - 349
//

Text Mined References (12)

PMID Year Title