Property Summary

NCBI Gene PubMed Count 12
PubMed Score 16.15
PubTator Score 4.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 3.9847093097355E-12
group 3 medulloblastoma 2254 4.21354951417518E-10
pediatric high grade glioma 2712 3.69442419175146E-7
glioblastoma 5572 1.46380894894023E-5
pilocytic astrocytoma 3086 6.85214744987032E-5
primitive neuroectodermal tumor 3031 0.00112039302588181
medulloblastoma, large-cell 6234 0.00194303685716599
atypical teratoid / rhabdoid tumor 4369 0.0127608620827009
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0

Expression

Synonym

Accession Q8NBI3 B6EV15 Q5SNX0 Q6UWK8
Symbols UNQ3119
neucrin
AGPA3119
C1orf187

Gene

  Ortholog (7)

Gene RIF (2)

PMID Text
24832731 results suggest that draxin functions as a repulsive guidance cue for PCN migration. However, we observed no significant differences in PCN distribution between draxin(-/-) and wild type embryos.
19857465 Neucrin is a unique secreted Wnt antagonist that is predominantly expressed in developing neural tissues.

AA Sequence

MAGPAIHTAPMLFLVLLLPLELSLAGALAPGTPARNLPENHIDLPGPALWTPQASHHRRRGPGKKEWGPG      1 - 70
LPSQAQDGAVVTATRQASRLPEAEGLLPEQSPAGLLQDKDLLLGLALPYPEKENRPPGWERTRKRSREHK     71 - 140
RRRDRLRLHQGRALVRGPSSLMKKAELSEAQVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTS    141 - 210
LRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDC    211 - 280
LPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV     281 - 349
//

Text Mined References (12)

PMID Year Title
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
24832731 2014 Inhibitory effects of draxin on axonal outgrowth and migration of precerebellar neurons.
19857465 2009 Neucrin is a novel neural-specific secreted antagonist to canonical Wnt signaling.
19150847 2009 Draxin, a repulsive guidance protein for spinal cord and forebrain commissures.
18347602 2008 Genomewide association for schizophrenia in the CATIE study: results of stage 1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.