Property Summary

NCBI Gene PubMed Count 25
PubMed Score 51.54
PubTator Score 55.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -2.500 5.9e-08
esophageal adenocarcinoma 1.300 1.8e-02
glioblastoma 1.700 1.5e-02
osteosarcoma -1.481 3.5e-03
posterior fossa group A ependymoma 1.500 3.7e-10
cystic fibrosis 2.205 3.2e-06
astrocytoma 1.400 3.9e-02
atypical teratoid / rhabdoid tumor 1.400 1.1e-04
primitive neuroectodermal tumor 1.300 8.1e-03
tuberculosis and treatment for 3 months -1.700 2.7e-06
non-small cell lung cancer -1.878 1.7e-14
lung cancer -4.400 4.3e-06
active Crohn's disease 2.566 5.0e-04
ulcerative colitis 2.400 1.7e-10
breast carcinoma 1.300 7.6e-03
lung adenocarcinoma -1.200 4.4e-07
pediatric high grade glioma 1.500 2.2e-06
pilocytic astrocytoma 1.900 1.7e-11
aldosterone-producing adenoma -1.309 1.2e-02
subependymal giant cell astrocytoma 2.854 4.7e-03
lung carcinoma -4.100 3.8e-31
ovarian cancer -2.200 4.6e-07

Gene RIF (17)

PMID Text
25633293 DRAM1 regulates apoptosis by inhibiting BAX degradation.
24922577 DRAM1 mediates autophagic defense against a broader range of intracellular pathogens, since DRAM1 expression was also induced by the common bacterial endotoxin lipopolysaccharide.
24556693 Suggest that promoting DRAM-mediated autophagy together with PI3K/AKT inhibition might be more effective for autophagy-based therapy in hepatoma.
24133622 DRAM is an important gene for the enhancement of p53-dependent apoptosis.
23832602 DRAM gene expression is down regulated by oxidative stress through the mediation of reactive oxygen species
23696801 DRAM1 affects autophagy through lysosomal acidification, fusion of lysosomes with autophagosomes and clearance of autophagosomes.
23658518 DRAM triggers lysosomal membrane permeabilization and cell death in CD4(+) T cells infected with HIV.
23337876 Overexpression of miR-199a-5p inhibits DRAM1 and Beclin1 expression.
22981223 p73-regulated DRAM-1 is functionally involved in neutrophil differentiation of acute promyelocytic leukemia cells.
22525272 these findings shed new light on the role of autophagy in GBM and reveal a novel function of the autophagy regulators DRAM1 and p62 in control of migration/invasion in cancer stem cells.
22082963 DRAM-1 encodes not just one mRNA, but a series of p53-inducible splice variants which are expressed at varying levels in multiple human and mouse cell lines.
21386980 Overexpression of DRAM induces VRK1 downregulation and the opposite effect was observed by its knockdown.
19706754 c-Jun NH2-terminal kinase as a novel mediator of DRAM protein regulation in Ewing sarcoma cells
19556885 DRAM is activated by p53 which is required for the ability of p53 to induce autophagy and is also critical for the ability of p53 to induce programmed cell death.
17397945 identified FLJ11259/DRAM as a p53-inducible member of a novel family of transmembrane proteins. FLJ11259/DRAM may be an important modulator of p53 responses in diverse tumor types.
17102582 DRAM links autophagy to p53 and programmed cell death.
16839881 Collectively therefore, these studies not only report a stress-induced regulator of autophagy but also highlight the relationship of DRAM and autophagy to p53 function and damage-induced programmed cell death.

AA Sequence

MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTPPESGIFGFMINFSAFLGAAT      1 - 70
MYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVPVVHDGGALLAFVCGVVYTLLQ     71 - 140
SIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASLISITKLEWNPREKDYVYHVVSAICEWTVAF    141 - 210
GFIFYFLTFIQDFQSVTLRISTEINGDI                                              211 - 238
//

Text Mined References (28)

PMID Year Title
25633293 2015 DRAM1 regulates apoptosis through increasing protein levels and lysosomal localization of BAX.
25416956 2014 A proteome-scale map of the human interactome network.
24922577 2014 The DNA damage-regulated autophagy modulator DRAM1 links mycobacterial recognition via TLR-MYD88 to autophagic defense [corrected].
24556693 2014 Phosphorylated AKT inhibits the apoptosis induced by DRAM-mediated mitophagy in hepatocellular carcinoma by preventing the translocation of DRAM to mitochondria.
24133622 2013 Overexpression of DRAM enhances p53-dependent apoptosis.
23832602 2013 Reactive oxygen species-dependent down-regulation of tumor suppressor genes PTEN, USP28, DRAM, TIGAR, and CYLD under oxidative stress.
23696801 2013 DRAM1 regulates autophagy flux through lysosomes.
23658518 2013 DRAM triggers lysosomal membrane permeabilization and cell death in CD4(+) T cells infected with HIV.
23337876 2013 Differential roles of miR-199a-5p in radiation-induced autophagy in breast cancer cells.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
22981223 2012 Inhibition of damage-regulated autophagy modulator-1 (DRAM-1) impairs neutrophil differentiation of NB4 APL cells.
22525272 2013 The autophagy-associated factors DRAM1 and p62 regulate cell migration and invasion in glioblastoma stem cells.
22082963 2012 DRAM-1 encodes multiple isoforms that regulate autophagy.
21386980 2011 Downregulation of VRK1 by p53 in response to DNA damage is mediated by the autophagic pathway.
19895784 2009 Reduced expression of DRAM2/TMEM77 in tumor cells interferes with cell death.
19706754 2009 c-Jun NH2-terminal kinase activation is essential for DRAM-dependent induction of autophagy and apoptosis in 2-methoxyestradiol-treated Ewing sarcoma cells.
19556885 2009 Analysis of DRAM-related proteins reveals evolutionarily conserved and divergent roles in the control of autophagy.
17397945 2007 The direct p53 target gene, FLJ11259/DRAM, is a member of a novel family of transmembrane proteins.
17304243 2007 p73 regulates DRAM-independent autophagy that does not contribute to programmed cell death.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17102582 DRAM links autophagy to p53 and programmed cell death.
16839881 2006 DRAM, a p53-induced modulator of autophagy, is critical for apoptosis.
16839873 2006 p53 and metabolism: Inside the TIGAR.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.