Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.36
PubTator Score 10.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 2.1e-03
cystic fibrosis -1.276 3.2e-05
group 3 medulloblastoma 1.300 7.8e-03
osteosarcoma 1.393 3.4e-04
permanent atrial fibrillation 1.100 1.0e-04
subependymal giant cell astrocytoma -1.865 2.2e-02

Gene RIF (2)

AA Sequence

MSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGGV      1 - 70
DVHTRLQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYEQWRERADSAACCDYSLHVD     71 - 140
ITRWHESIKEELEALVKEKGVNSFLVFMAYKDRCQCSDSQMYEIFSIIRDLGALAQVHAENGDIVEEEQK    141 - 210
RLLELGITGPEGHVLSHPEEVEAEAVYRAVTIAKQANCPLYVTKVMSKGAADAIAQAKRRGVVVFGEPIT    211 - 280
ASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFAL    281 - 350
IPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKII    351 - 420
SAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLAE    421 - 490
IHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIMA    491 - 560
PPGGRSNITSLS                                                              561 - 572
//

Text Mined References (12)

PMID Year Title