Property Summary

NCBI Gene PubMed Count 30
PubMed Score 82.70
PubTator Score 36.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -4.500 1.0e-07
astrocytoma 2.400 2.5e-02
ependymoma 2.100 3.0e-03
oligodendroglioma 2.300 7.5e-04
psoriasis -2.100 8.4e-04
glioblastoma 2.100 6.7e-03
group 3 medulloblastoma 2.900 2.5e-05
medulloblastoma, large-cell 1.800 7.9e-05
primitive neuroectodermal tumor 2.300 2.7e-05
Atopic dermatitis -1.200 4.4e-03
tuberculosis -1.500 1.9e-04
primary pancreatic ductal adenocarcinoma 2.317 1.8e-04
intraductal papillary-mucinous adenoma (... -2.000 3.5e-03
lung cancer 2.400 1.5e-05
colon cancer -2.200 7.8e-03
pancreatic cancer 2.600 9.3e-04
pediatric high grade glioma 1.700 2.3e-05
pilocytic astrocytoma 2.300 1.6e-08
subependymal giant cell astrocytoma 1.327 2.1e-02
lung carcinoma 1.500 2.6e-13
Breast cancer -1.300 5.5e-05
invasive ductal carcinoma -1.200 2.1e-02
ulcerative colitis 1.300 6.9e-04
ovarian cancer 2.200 2.3e-05
pituitary cancer 2.600 4.1e-08

Gene RIF (15)

PMID Text
25173447 DPYSL3 expression levels inversely correlated with those of VEGF and FAK. Down-regulation of DPYSL3 expression in HCC tissues may serve as a predictive biomarker for HCC after curative resection.
25096402 Expression status of DPYSL3 in gastric cancer tissues may represent a promising biomarker for the malignant behavior of GC.
24914979 structures provide further insight into the effects of medically relevant mutations of the DPYSL-3 gene encoding CRMP-4 and the putative enzymatic activities of CRMPs
24339867 DPYSL3 as pancreatic ductal adenocarcinoma-associated molecule that regulates cell adhesion and migration by stabilization of focal adhesion complex
24011394 Downregulation of MYCN by small interfering RNA (siRNA) increased DPYSL3 levels, while upregulation of MYCN in non-MYCN NB cells decreased DPYSL3 levels.
23568759 study found the association between the rs147541241 variant and amyotrophic lateral scerosis was limited to the French population
22805864 High collapsin response mediator protein 4 expression is associated with liver metastasis in pancreatic cancer.
21179545 CRMP4 is a key physiological substrate of GSK3 in regulating chromosomal alignment and mitotic progression through its effect on spindle microtubules
20977846 Ulip1 was downregulated and HIF1a was upregulated in hypoxic neuroblastoma cells.
20804502 Data show that two genes, LTB4DH and DPYSL3, were confirmed to be candidate genes for the predictor of a good immune response.
20543870 new function of CRMP4 as a metastasis-suppressor in lymph node metastasis of prostate cancer
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16611631 GSK3 alters phosphorylation of CRMP-1, -2, and -4 isoforms
15933812 HUlip was expressed in late fetal and early postnatal brains in the neurons of the brain stem, basal ganglia/thalamus, and dentate gyrus of the hippocampus. HUlip expression was easily detected in tumor cells undergoing neuronal differentiation. [Ulip]
11771764 Aberrant expression of dihydropyrimidinase related proteins-2,-3 and -4 in fetal Down syndrome brain.

AA Sequence

MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGI      1 - 70
DVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVD     71 - 140
ITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQT    141 - 210
RMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPIT    211 - 280
ASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTA    281 - 350
IPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIV    351 - 420
SAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMAD    421 - 490
LHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPP    491 - 560
GGRSNITSLS                                                                561 - 570
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25358863 2014 Amino- and carboxyl-terminal domains of Filamin-A interact with CRMP1 to mediate Sema3A signalling.
25173447 2015 Dihydropyrimidinase-like 3 is a putative hepatocellular carcinoma tumor suppressor.
25096402 2014 Dihydropyrimidinase-like 3 facilitates malignant behavior of gastric cancer.
24914979 2014 Crystal structure of human CRMP-4: correction of intensities for lattice-translocation disorder.
24339867 2013 Quantitative proteomic profiling identifies DPYSL3 as pancreatic ductal adenocarcinoma-associated molecule that regulates cell adhesion and migration by stabilization of focal adhesion complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24011394 2013 Dihydropyrimidinase-like protein 3 expression is negatively regulated by MYCN and associated with clinical outcome in neuroblastoma.
23568759 2013 A rare motor neuron deleterious missense mutation in the DPYSL3 (CRMP4) gene is associated with ALS.
22805864 2013 Collapsin response mediator protein 4 expression is associated with liver metastasis and poor survival in pancreatic cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21179545 2010 GSK3 regulates mitotic chromosomal alignment through CRMP4.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20977846 2010 [The changes in expression of uncoordinated 33-like phosphoprotein 1 and hypoxia-inducible factor-1? in neuroblastoma cells under hypoxic condition].
20804502 2010 A set of genes associated with the interferon-? response of lung cancer patients undergoing ?-galactosylceramide-pulsed dendritic cell therapy.
20543870 2010 Expression profiling identifies new function of collapsin response mediator protein 4 as a metastasis-suppressor in prostate cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16611631 2006 Distinct priming kinases contribute to differential regulation of collapsin response mediator proteins by glycogen synthase kinase-3 in vivo.
15933812 2005 HUlip, a human homologue of unc-33-like phosphoprotein of Caenorhabditis elegans; Immunohistochemical localization in the developing human brain and patterns of expression in nervous system tumors.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
12745088 2003 Subcellular localization of collapsin response mediator proteins to lipid rafts.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444086 2003 Collapsin response mediator proteins of neonatal rat brain interact with chondroitin sulfate.
11771764 2001 Aberrant expression of dihydropyrimidinase related proteins-2,-3 and -4 in fetal Down syndrome brain.
10956643 2000 Molecular characterization of CRMP5, a novel member of the collapsin response mediator protein family.
10748015 2000 Structure and promoter analysis of the human unc-33-like phosphoprotein gene. E-box required for maximal expression in neuroblastoma and myoblasts.
10664068 2000 Differential expression of dihydropyrimidinase-related protein genes in developing and adult enteric nervous system.
9115293 1997 Identification and characterization of a retinoic acid-regulated human homologue of the unc-33-like phosphoprotein gene (hUlip) from neuroblastoma cells.
8973361 1996 A novel gene family defined by human dihydropyrimidinase and three related proteins with differential tissue distribution.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.