Property Summary

NCBI Gene PubMed Count 31
PubMed Score 87.12
PubTator Score 36.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 1.500 4.2e-04
astrocytic glioma 2.000 9.6e-04
Astrocytoma, Pilocytic 2.200 1.9e-08
Atopic dermatitis -1.200 4.4e-03
Breast cancer -1.300 5.5e-05
colon cancer -2.200 7.8e-03
ependymoma 2.100 3.0e-03
glioblastoma 1.600 2.1e-06
group 3 medulloblastoma 2.900 2.5e-05
intraductal papillary-mucinous adenoma (... -2.000 3.5e-03
invasive ductal carcinoma -1.200 2.1e-02
lung cancer 1.400 2.3e-04
lung carcinoma 1.500 2.6e-13
malignant mesothelioma -4.500 1.0e-07
medulloblastoma, large-cell 1.600 2.5e-04
oligodendroglioma 2.300 7.5e-04
ovarian cancer -2.000 8.8e-05
pancreatic cancer 1.200 6.3e-03
pituitary cancer 2.600 4.1e-08
primary pancreatic ductal adenocarcinoma 1.519 3.3e-03
primitive neuroectodermal tumor 1.700 1.6e-02
psoriasis -1.200 1.2e-04
subependymal giant cell astrocytoma 1.327 2.1e-02
tuberculosis -1.500 1.9e-04
ulcerative colitis 1.300 6.9e-04

Protein-protein Interaction (3)

Gene RIF (16)

AA Sequence

MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGI      1 - 70
DVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVD     71 - 140
ITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQT    141 - 210
RMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPIT    211 - 280
ASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTA    281 - 350
IPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIV    351 - 420
SAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMAD    421 - 490
LHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPP    491 - 560
GGRSNITSLS                                                                561 - 570
//

Text Mined References (35)

PMID Year Title