Property Summary

NCBI Gene PubMed Count 79
PubMed Score 212.54
PubTator Score 108.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.548 3.3e-02
atypical teratoid / rhabdoid tumor -1.900 2.2e-04
medulloblastoma, large-cell -1.600 2.3e-03
Duchenne muscular dystrophy 1.589 1.9e-07
limb girdle muscular dystrophy 2I 1.054 3.6e-03
autosomal dominant Emery-Dreifuss muscul... 1.402 7.4e-03
Becker muscular dystrophy 1.204 6.8e-03
tuberculosis 2.500 8.6e-10
primary pancreatic ductal adenocarcinoma 1.487 1.7e-03
non-small cell lung cancer -1.955 1.1e-23
lung cancer -2.800 3.3e-06
lung adenocarcinoma -2.300 6.3e-16
subependymal giant cell astrocytoma -1.248 8.3e-03
Breast cancer -2.300 2.7e-13
breast carcinoma -1.600 1.4e-37
gastric carcinoma 1.200 1.4e-02
ductal carcinoma in situ -1.100 1.6e-03
invasive ductal carcinoma -1.900 4.7e-04
acute myeloid leukemia -2.600 1.8e-03
ulcerative colitis 1.100 6.8e-04
ovarian cancer -3.700 7.9e-08
pancreatic cancer 1.500 9.8e-04
dermatomyositis 1.100 1.5e-02

 GO Function (1)

 MGI Phenotype (1)

Gene RIF (57)

PMID Text
26555036 These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells
25847191 polymorphisms of the DPYSL2 gene in humans may be associated with the development of schizophrenia.
25760044 HIV-1 Tat induces hyperphosphorylation of CRMP2 in neuronal cells
25416705 Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling
25224486 Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs.
24634145 Levels of total GSK3 were decreased in the Huntington disease-affected frontal cortex and this correlated with decreased phosphorylated CRMP2.
24518087 High dihydropyrimidinase-related protein 2 expression is associated with lung cancer.
24133216 A specific and reversible intermolecular Cys-504-Cys-504 dithiol-disulfide switch in homotetrameric CRMP2 determines two conformations of the quaternary CRMP2 complex that controls axonal outgrowth and thus neuronal development.
24036111 CRMP-2-dependent regulation of ROCK II activity is mediated through interaction of the CRMP-2L N terminus with the ROCK II catalytic domain as well as by GSK3-dependent phosphorylation of CRMP-2.
23846846 genetic variants in DPYSL2 may play a role in susceptibility to alcohol dependence.
23836888 a novel regulatory mechanism that utilizes CRMP2 SUMOylation to choreograph NaV1.7 trafficking.
23381229 Reduced CRMP2 expression and elevated expression of nuclear phosphorylated CRMP2 may be associated with breast cancer progression.
23185275 Deletion analysis of CRMP-2 identified a 51 amino acid sequence in the C-terminus that is required for targeting to the basal body and primary cilium. This domain contains GSK-3beta phosphorylation sites.
23166591 HIV-1 Tat induces hyperphosphorylation of CRMP2 in neuronal cells
23023514 High levels of nuclear phosphorylated CRMP-2 is associated with lung cancer.
22954668 No Alzheimer disease-associated differences in CNP and DPYSL2 promoter DNA methylation were observed.
22443207 findings suggest a major role of phosphorylated CRMP-2 as a mechanism involved in process retraction induced by reactive oxygen species
22431514 a new insight into CRMP-2 as a controller of myosin II-mediated cellular functions through the inhibition of ROCK II in nonneuronal cells
22279220 CRMP2 controls dendritic projection; the phosphorylation of CRMP2 at Ser522 is essential for proper dendritic field organization for axonal guidance and spine development .
22227566 HTLV-1 has the capacity to influence the CRMP2/PI3K/Akt axis thus to positively control cytoskeleton organization and lymphocyte migration.
21860090 CRMP2 hyperphosphorylation is speci fi c to Alzheimer's disease and is not a common event in all forms of dementia and neurodegeneration, especially other tauopathies.
21694731 HIV-1 Tat induces hyperphosphorylation of CRMP2 in neuronal cells
21642979 HIV-1 Tat induces hyperphosphorylation of CRMP2 in neuronal cells
21302347 Data support DPYSL2 and the surrounding genomic region as a susceptibility locus for schizophrenia.
21271304 This review discusses the essential biology of CRMP2 in the context of nascent data implicating CRMP2 perturbations as either a correlate of, or plausible contributor to, diverse neuropathologies.
20801876 Data provide the first trafficking regulatory role for Crmp2 in non-neuronal cells and support a model in which Crmp2 is an important endocytic regulatory protein that links MICAL-L1.EHD1-based vesicular transport to dynein motors.
20414250 DPYSL2 does not have a major function in schizophrenia in Japanese subjects.
20414250 Observational study of gene-disease association. (HuGE Navigator)
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19666111 CRMP2 as a tubulin direct binder may be a GTPase-activating protein (GAP) of tubulin in neurite formation and its GAP activity may be regulated by an intramolecular interaction with an N-terminal inhibitory region.
19659462 Given that CRMP-2 is a key regulator of axon elongation, this interference with cytoplasmic dynein function by CRMP-2 might have an important role in axon formation, and neuronal development
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19328558 Observational study of gene-disease association. (HuGE Navigator)
19151921 Data suggest that collapsin response mediator protein-2 (CRMP-2) is a novel calmodulin-binding protein and that CaM binding may play an important role in regulating CRMP-2 functions.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18460467 relative resistance to phosphatases might be a common feature of Cdk5 substrates and could contribute to the hyperphosphorylation of CRMP2 and Tau observed in Alzheimer disease
18218617 association of neurofibromin and CRMP-2 is essential for neuronal cell differentiation
18203259 results indicate that that CRMP-2 may be a novel colorectal cancer biomarker
17683481 These observations implicate hyperphosphorylation of CRMP2 as an early event in the development of AD and suggest that it can be induced by a severe APP over-expression and/or processing defect.
17229153 collapsin response mediator protein-2 transcriptional activity is inhibited by all-trans-retinoic acid during SH-SY5Y neuroblastoma cell differentiation
17105906 Observational study of gene-disease association. (HuGE Navigator)
16611631 GSK3 alters phosphorylation of CRMP-1, -2, and -4 isoforms
16380905 Observational study of gene-disease association. (HuGE Navigator)
16321170 Observational study of gene-disease association. (HuGE Navigator)
16260607 CRMP-2 transports the Sra-1/WAVE1 complex to axons in a kinesin-1-dependent manner and thereby regulates axon outgrowth and formation
15858820 Observational study of gene-disease association. (HuGE Navigator)
15858820 A significant association was found between a single nucleotide polymorphism of the DRP-2 gene and schizophrenia in a North American sample.
15672539 significant decrease of crmp-2 protein may represent or underlie impaired neuronal plasticity, neurodegeneration, wiring of the brain in mesial temporal lobe epilepsy
15207709 Here we show that glial cell line-derived neurotrophic factor (GDNF) enhances CRMP-2 expression in TGW human neuroblastoma cells via activation of RET receptor tyrosine kinase.
15027329 Observational study of gene-disease association. (HuGE Navigator)
12951196 Observational study of gene-disease association. (HuGE Navigator)
12951196 No significant associations were found between five polymorphisms of the DRP-2 gene and Bipolar Disorder, nor were associations detected between either of the polymorphisms and bipolar subtypes I and II.
12679234 Observational study of gene-disease association. (HuGE Navigator)
12482610 CRMP-1 and CRMP-2 have a role in RhoA-dependent signaling, through interaction with and regulation of ROKalpha
11771764 Aberrant expression of dihydropyrimidinase related proteins-2,-3 and -4 in fetal Down syndrome brain.

AA Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGI      1 - 70
DVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVD     71 - 140
ISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQ    141 - 210
RILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPIT    211 - 280
ASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL    281 - 350
IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI    351 - 420
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE    421 - 490
LRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVA    491 - 560
PPGGRANITSLG                                                              561 - 572
//

Text Mined References (95)

PMID Year Title
26555036 2015 Phosphorylation of a splice variant of collapsin response mediator protein 2 in the nucleus of tumour cells links cyclin dependent kinase-5 to oncogenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25847191 2015 Changes in Dpysl2 expression are associated with prenatally stressed rat offspring and susceptibility to schizophrenia in humans.
25416956 2014 A proteome-scale map of the human interactome network.
25416705 2014 Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling.
25224486 2015 Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.
24634145 2014 Localized changes to glycogen synthase kinase-3 and collapsin response mediator protein-2 in the Huntington's disease affected brain.
24518087 2014 Discovery of new membrane-associated proteins overexpressed in small-cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24133216 2013 Identification of a dithiol-disulfide switch in collapsin response mediator protein 2 (CRMP2) that is toggled in a model of neuronal differentiation.
24036111 2013 Phosphorylation and mRNA splicing of collapsin response mediator protein-2 determine inhibition of rho-associated protein kinase (ROCK) II function in carcinoma cell migration and invasion.
23846846 2014 Association between DPYSL2 gene polymorphisms and alcohol dependence in Caucasian samples.
23836888 2013 CRMP2 protein SUMOylation modulates NaV1.7 channel trafficking.
23381229 2014 Collapsin response mediator protein 2 is involved in regulating breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185275 2012 Targeting of CRMP-2 to the primary cilium is modulated by GSK-3?.
23023514 2013 Phosphorylated tubulin adaptor protein CRMP-2 as prognostic marker and candidate therapeutic target for NSCLC.
22954668 2013 CNP and DPYSL2 mRNA expression and promoter methylation levels in brain of Alzheimer's disease patients.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22443207 2012 Collapsin response mediator protein-2 phosphorylation promotes the reversible retraction of oligodendrocyte processes in response to non-lethal oxidative stress.
22431514 2012 A collapsin response mediator protein 2 isoform controls myosin II-mediated cell migration and matrix assembly by trapping ROCK II.
22279220 2012 Phosphorylation of CRMP2 (collapsin response mediator protein 2) is involved in proper dendritic field organization.
22227566 2012 Human T lymphotropic virus type 1 increases T lymphocyte migration by recruiting the cytoskeleton organizer CRMP2.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21860090 2011 CRMP2 hyperphosphorylation is characteristic of Alzheimer's disease and not a feature common to other neurodegenerative diseases.
21832084 2011 Neuroprotection against traumatic brain injury by a peptide derived from the collapsin response mediator protein 2 (CRMP2).
21642979 2011 Suppression of inflammatory and neuropathic pain by uncoupling CRMP-2 from the presynaptic Ca²? channel complex.
21521879 2011 Thioredoxin mediates oxidation-dependent phosphorylation of CRMP2 and growth cone collapse.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21302347 2011 Linkage and association on 8p21.2-p21.1 in schizophrenia.
21271304 2011 Collapsin response mediator protein-2: an emerging pathologic feature and therapeutic target for neurodisease indications.
21269460 2011 Initial characterization of the human central proteome.
20801876 2010 Collapsin response mediator protein-2 (Crmp2) regulates trafficking by linking endocytic regulatory proteins to dynein motors.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20414250 2010 A two-stage case-control association study of the dihydropyrimidinase-like 2 gene (DPYSL2) with schizophrenia in Japanese subjects.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19666111 2009 Collapsin response mediator protein-2 regulates neurite formation by modulating tubulin GTPase activity.
19659462 2009 CRMP-2 directly binds to cytoplasmic dynein and interferes with its activity.
19652227 2009 Semaphorin3A signaling mediated by Fyn-dependent tyrosine phosphorylation of collapsin response mediator protein 2 at tyrosine 32.
19519308 2009 Increased CRMP2 phosphorylation is observed in Alzheimer's disease; does this tell us anything about disease development?
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19405953 2009 Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19235893 2009 Protein product of CLN6 gene responsible for variant late-onset infantile neuronal ceroid lipofuscinosis interacts with CRMP-2.
19151921 2009 Collapsin response mediator protein-2 is a calmodulin-binding protein.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18460467 2008 Relative resistance of Cdk5-phosphorylated CRMP2 to dephosphorylation.
18218617 2008 Neurofibromatosis type 1 (NF1) tumor suppressor, neurofibromin, regulates the neuronal differentiation of PC12 cells via its associating protein, CRMP-2.
18203259 2008 Identification of collapsin response mediator protein-2 as a potential marker of colorectal carcinoma by comparative analysis of cancer cell secretomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17683481 2007 Collapsin response mediator protein-2 hyperphosphorylation is an early event in Alzheimer's disease progression.
17250651 2007 The structure of human collapsin response mediator protein 2, a regulator of axonal growth.
17229153 2007 All-trans-retinoic acid inhibits collapsin response mediator protein-2 transcriptional activity during SH-SY5Y neuroblastoma cell differentiation.
17105906 2006 Association study of the dihydropyrimidinase-related protein 2 gene and methamphetamine psychosis.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16611631 2006 Distinct priming kinases contribute to differential regulation of collapsin response mediator proteins by glycogen synthase kinase-3 in vivo.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16380905 2005 Bipolar I disorder and schizophrenia: a 440-single-nucleotide polymorphism screen of 64 candidate genes among Ashkenazi Jewish case-parent trios.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16321170 2006 An investigation of the dihydropyrimidinase-like 2 (DPYSL2) gene in schizophrenia: genetic association study and expression analysis.
16260607 2005 CRMP-2 is involved in kinesin-1-dependent transport of the Sra-1/WAVE1 complex and axon formation.
15858820 2005 Dihydropyrimidinase-related protein 2 (DRP-2) gene and association to deficit and nondeficit schizophrenia.
15672539 2004 Reduction of hippocampal collapsin response mediated protein-2 in patients with mesial temporal lobe epilepsy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466863 2004 GSK-3 phosphorylation of the Alzheimer epitope within collapsin response mediator proteins regulates axon elongation in primary neurons.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15207709 2004 Induction of CRMP-2 by GDNF and analysis of the CRMP-2 promoter region.
15027329 2004 [The human dihydropyrimidinase-related protein 2 (DRP-2) gene on chromosome 8p21 is associated with paranoid-type schizophrenia].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685275 2004 Structural bases for CRMP function in plexin-dependent semaphorin3A signaling.
12951196 2003 No association between the dihydropyrimidinase-related protein 2 (DRP-2) gene and bipolar disorder in humans.
12942088 2003 CRMP-2 regulates polarized Numb-mediated endocytosis for axon growth.
12679234 2003 The human dihydropyrimidinase-related protein 2 gene on chromosome 8p21 is associated with paranoid-type schizophrenia.
12482610 2002 p80 ROKalpha binding protein is a novel splice variant of CRMP-1 which associates with CRMP-2 and modulates RhoA-induced neuronal morphology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12134159 2002 CRMP-2 binds to tubulin heterodimers to promote microtubule assembly.
11771764 2001 Aberrant expression of dihydropyrimidinase related proteins-2,-3 and -4 in fetal Down syndrome brain.
11741937 2002 Collapsin response mediator protein-2 inhibits neuronal phospholipase D(2) activity by direct interaction.
11477421 2001 CRMP-2 induces axons in cultured hippocampal neurons.
11121447 2000 Numb is an endocytic protein.
10956643 2000 Molecular characterization of CRMP5, a novel member of the collapsin response mediator protein family.
10818093 2000 Phosphorylation of collapsin response mediator protein-2 by Rho-kinase. Evidence for two separate signaling pathways for growth cone collapse.
10770920 2000 Evidence that collapsin response mediator protein-2 is involved in the dynamics of microtubules.
10757975 2000 Neurofibrillary tangle-associated collapsin response mediator protein-2 (CRMP-2) is highly phosphorylated on Thr-509, Ser-518, and Ser-522.
10574455 1999 Characterization of the human dihydropyrimidinase-related protein 2 (DRP-2) gene.
8973361 1996 A novel gene family defined by human dihydropyrimidinase and three related proteins with differential tissue distribution.
8640231 1996 Characterization of DRP2, a novel human dystrophin homologue.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7637782 1995 Collapsin-induced growth cone collapse mediated by an intracellular protein related to UNC-33.