Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1232.91
PubTator Score 32.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Varicosity 4
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 2.0

Expression

  Differential Expression (26)

Disease log2 FC p
psoriasis -2.400 8.3e-05
Duchenne muscular dystrophy 1.959 2.4e-08
autosomal dominant Emery-Dreifuss muscul... 1.513 9.4e-03
limb girdle muscular dystrophy 2A 1.461 2.5e-04
Becker muscular dystrophy 1.438 1.5e-03
Atopic dermatitis -1.300 1.9e-03
adrenocortical adenoma -1.782 2.0e-02
adrenocortical carcinoma -2.460 3.8e-06
non-small cell lung cancer -1.362 1.1e-06
intraductal papillary-mucinous adenoma (... -4.600 1.0e-06
intraductal papillary-mucinous carcinoma... -6.100 2.3e-08
intraductal papillary-mucinous neoplasm ... -6.200 9.9e-06
colon cancer -4.100 5.1e-06
lung cancer -3.800 1.4e-06
pancreatic cancer -1.800 2.4e-04
breast carcinoma -2.900 1.9e-05
fibroadenoma -2.800 2.6e-03
interstitial cystitis -2.400 1.1e-03
lung adenocarcinoma -2.100 1.6e-10
non primary Sjogren syndrome sicca 1.300 1.1e-02
aldosterone-producing adenoma -1.559 1.8e-02
invasive ductal carcinoma -3.600 3.5e-04
non-inflammatory breast cancer -2.100 4.3e-03
lung carcinoma -2.900 1.8e-20
ductal carcinoma in situ -2.900 5.6e-04
ovarian cancer -1.300 2.0e-03

Gene RIF (12)

PMID Text
25509878 The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia.
25304290 Lumican, decorin and dermatopontin are differentially expressed and may serve as biomarkers for metastatic and recurrent Giant cell tumor of bone
25260909 This study essentially deals with assessing the expression and integrity of an extracellular matrix protein, Dermatopontin (DPT), in chronic cutaneous wounds.
25082449 dermatopontin functional peptide produces fibrinogen fibrils and modifies its biological activity
23877568 These results indicate that DPT can modify certain biological functions of fibrin, and thus a another function of this extracellular matrix protein was revealed.
21796630 data provided strong evidence that downregulation of DPT is a characteristic event in human oral squamous cell carcinoma and that DPT was correlated with cellular adhesion and invasiveness.
21398523 DPT has an accelerating role in fibroblast cell adhesion to the provisional matrix in the initial stage of wound healing.
19916908 suggests that dermatopontin can play various roles in different tissues and might be a molecule related to carcinogenesis and the progression of HCC via possible interaction with TGF-beta1 and other potential mechanisms
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
17547532 roles of dermatopontin and histamine receptor H1 genes as downstream targets for the VDR were confirmed by gel electromotility shift and chromatin immunoprecipitation assays that showed the presence of VDR complex binding sequences
11810028 HIV-1 Nef-induced upregulation of tyrosine-rich acidic matrix protein (TRAMP) is found in Nef expressing HeLa cells

AA Sequence

MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSD      1 - 70
RQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCP     71 - 140
YSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV             141 - 201
//

Text Mined References (26)

PMID Year Title
25509878 [The effects of simulated microgravity on the pattern of gene expression in human bone marrow mesenchymal stem cells under osteogenic differentiation].
25304290 2014 Gene expression profiling of giant cell tumor of bone reveals downregulation of extracellular matrix components decorin and lumican associated with lung metastasis.
25260909 2014 Expression and integrity of dermatopontin in chronic cutaneous wounds: a crucial factor in impaired wound healing.
25082449 2014 Functional peptide of dermatopontin produces fibrinogen fibrils and modifies its biological activity.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23877568 2014 Dermatopontin regulates fibrin formation and its biological activity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21796630 2012 Dermatopontin: a potential predictor for metastasis of human oral cancer.
21398523 2011 Dermatopontin interacts with fibronectin, promotes fibronectin fibril formation, and enhances cell adhesion.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19916908 2009 Dermatopontin is expressed in human liver and is downregulated in hepatocellular carcinoma.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
17547532 2007 Histamine receptor H1 and dermatopontin: new downstream targets of the vitamin D receptor.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10233760 1999 Dermatopontin expression is decreased in hypertrophic scar and systemic sclerosis skin fibroblasts and is regulated by transforming growth factor-beta1, interleukin-4, and matrix collagen.
9895299 1999 Dermatopontin interacts with transforming growth factor beta and enhances its biological activity.
8104875 1993 Complementary DNA sequence and chromosomal mapping of a human proteoglycan-binding cell-adhesion protein (dermatopontin).
8082810 1994 Tyrosine-rich acidic matrix protein (TRAMP) is a tyrosine-sulphated and widely distributed protein of the extracellular matrix.