Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.73
PubTator Score 9.23

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV      1 - 70
YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK                             71 - 116
//

Text Mined References (13)

PMID Year Title