Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.89
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.7e-11
non primary Sjogren syndrome sicca 840 2.5e-02
acute myeloid leukemia 785 3.1e-02
Disease Target Count Z-score Confidence
Embryonal carcinoma 11 3.389 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.674 1.7e-11
non primary Sjogren syndrome sicca -1.200 2.5e-02
acute myeloid leukemia -2.500 3.1e-02

Gene RIF (5)

PMID Text
26687479 knockdown of PCGF1 results in reduced expression of DPPA4 and other subunits of the variant PRC1 complex at both mRNA and protein levels
23963736 Results identified a new family of pluripotency-related oncogenes consisting of DPPA2 and DPPA4.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18366076 Thsi study identifies DPPA4 and other genes as putative Sox2:Oct-3/4 target genes using a combination of in silico analysis and transcription-based assays.

AA Sequence

MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHT      1 - 70
DNPRPQKKIPIPPLPSKLPPVNLIHRDILRAWCQQLKLSSKGQKLDAYKRLCAFAYPNQKDFPSTAKEAK     71 - 140
IRKSLQKKLKVEKGETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVVVTTSAPEALLASWARIS    141 - 210
ARARTPEAVESPQEASGVRWCVVHGKSLPADTDGWVHLQFHAGQAWVPEKQEGRVSALFLLPASNFPPPH    211 - 280
LEDNMLCPKCVHRNKVLIKSLQWE                                                  281 - 304
//

Text Mined References (19)

PMID Year Title
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
23963736 2013 Identification of DPPA4 and DPPA2 as a novel family of pluripotency-related oncogenes.
23761726 2013 Interrogation of the platelet-derived growth factor receptor alpha locus and corneal astigmatism in Australians of Northern European ancestry: results of a genome-wide association study.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18366076 2008 Identification of DPPA4 and other genes as putative Sox2:Oct-3/4 target genes using a combination of in silico analysis and transcription-based assays.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12620990 2003 Incomplete reactivation of Oct4-related genes in mouse embryos cloned from somatic nuclei.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.