Property Summary

Ligand Count 286
NCBI Gene PubMed Count 27
PubMed Score 78.04
PubTator Score 58.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 2.2e-04
atypical teratoid / rhabdoid tumor -1.600 1.4e-05
glioblastoma -1.100 1.4e-03
group 4 medulloblastoma -1.100 6.2e-03
intraductal papillary-mucinous adenoma (... 1.200 2.9e-02
intraductal papillary-mucinous neoplasm ... 1.100 7.5e-03
medulloblastoma, large-cell -1.800 8.6e-05
Multiple myeloma 1.704 3.0e-04
osteosarcoma -1.640 9.6e-06
ovarian cancer -1.900 1.8e-10
Waldenstrons macroglobulinemia 1.610 2.6e-03

Gene RIF (14)

AA Sequence

MWKRSEQMKIKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRK      1 - 70
YHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQ     71 - 140
ATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETS    141 - 210
CPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRY    211 - 280
SGYWWCPKAETTPSGGKILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMI    281 - 350
DAEGRIIDVIDKELIQPFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVM    351 - 420
ERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLYKITSILKESK    421 - 490
YKRSSGGLPAPSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVSYVNP    491 - 560
GEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATILDSAGPLPDY    561 - 630
TPPEIFSFESTTGFTLYGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVV    631 - 700
VIDNRGSCHRGLKFEGAFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSD    701 - 770
IFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAH    771 - 840
TSILLSFLVRAGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI                841 - 898
//

Text Mined References (27)

PMID Year Title