Property Summary

NCBI Gene PubMed Count 356
PubMed Score 4090.96
PubTator Score 2858.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -8.300 0.000
Barrett's esophagus 1.100 0.035
uncontrolled asthma 2.700 0.000
cystic fibrosis 1.783 0.000
glioblastoma 1.400 0.024
tuberculosis 1.100 0.001
Common variable immunodeficiency -1.039 0.004
lung cancer -4.300 0.000
interstitial cystitis 1.200 0.000
pediatric high grade glioma 1.500 0.038
lung adenocarcinoma 1.995 0.002
lung carcinoma -2.800 0.000
non-small cell lung carcinoma 1.100 0.000
invasive ductal carcinoma -1.900 0.007
ovarian cancer -3.400 0.000

Synonym

Accession P27487 Q53TN1
Symbols CD26
ADABP
ADCP2
DPPIV
TP103

Gene

PDB

1J2E   1N1M   1NU6   1NU8   1PFQ   1R9M   1R9N   1RWQ   1TK3   1TKR   1U8E   1W1I   1WCY   1X70   2AJL   2BGN   2BGR   2BUB   2FJP   2G5P   2G5T   2G63   2HHA   2I03   2I78   2IIT   2IIV   2JID   2OAG   2OGZ   2OLE   2ONC   2OPH   2OQI   2OQV   2P8S   2QJR   2QKY   2QOE   2QT9   2QTB   2RGU   2RIP   3BJM   3C43   3C45   3CCB   3CCC   3D4L   3EIO   3F8S   3G0B   3G0C   3G0D   3G0G   3H0C   3HAB   3HAC   3KWF   3KWJ   3NOX   3O95   3O9V   3OC0   3OPM   3Q0T   3Q8W   3QBJ   3SWW   3SX4   3VJK   3VJL   3VJM   3W2T   3WQH   4A5S   4DSA   4DSZ   4DTC   4G1F   4J3J   4JH0   4KR0   4L72   4LKO   4N8D   4N8E   4PNZ   4PV7   4QZV   5I7U   5ISM   5KBY  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (315)

PMID Text
26992252 Serum DPPIV concentration in patients with COPD is decreased significantly, and there is no correlation between serum DPPIV concentration and sex or age.
26975422 DPP4 may be involved in the pathologic features of asthmatic airway inflammation and cell proliferation and FN production.
26889022 Lack of DPP4 expression may be the primary cause of limited MERS-CoV replication in the human upper respiratory tract and hence restrict transmission.
26872429 Based on our previous observation that sDPP4 induces insulin resistance in adipocytes, we suggest dpp4 is a regulator of insulin signaling.
26856537 Results identified heart expression of DPP4 to be coordinated with a gene expression signature characteristic for whole blood proliferation, potentially impacting peripheral stem cell mobilization.
26826382 In conclusion, each of the DPP-4 inhibitors may have unique drug-specific effects.
26701103 Loss of DPP4 is associated with Multi-Organ Damage in Human Dipeptidyl Peptidase 4 Transgenic Mice Infected with Middle East Respiratory Syndrome-Coronavirus.
26644312 decreased T-cell expression and lower plasma levels in Indian patients with Post Kala-azar Dermal Leishmaniasis
26552750 Consistent with the loss of CXCR4 and gain in CD26, migratory responses to exogenous CXCL12 were eliminated in cells pretreated with cytotoxic agents, although cells retained basal motility
26474470 Serum sCD26/DPP-IV levels increased in T2DM subjects with and without MetS
More...

AA Sequence

MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLY      1 - 70
KQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKR     71 - 140
QLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSA    141 - 210
YSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVT    211 - 280
NATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMST    281 - 350
TGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN    351 - 420
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKG    421 - 490
LRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFR    491 - 560
LNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWS    561 - 630
YGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEY    631 - 700
LLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP        701 - 766
//

Text Mined References (371)

PMID Year Title
26992252 2016 Expression and Clinical Significance of Serum Dipeptidyl Peptidase IV Chronic Obstructive Pulmonary Disease.
26975422 2016 Dipeptidyl peptidase-4 is highly expressed in bronchial epithelial cells of untreated asthma and it increases cell proliferation along with fibronectin production in airway constitutive cells.
26889022 2016 Differential Expression of the Middle East Respiratory Syndrome Coronavirus Receptor in the Upper Respiratory Tracts of Humans and Dromedary Camels.
26872429 2016 Reduced DPP4 activity improves insulin signaling in primary human adipocytes.
26856537 2016 Inter-tissue coexpression network analysis reveals DPP4 as an important gene in heart to blood communication.
26826382 2016 Linagliptin but not Sitagliptin inhibited transforming growth factor-?2-induced endothelial DPP-4 activity and the endothelial-mesenchymal transition.
26701103 2015 Multi-Organ Damage in Human Dipeptidyl Peptidase 4 Transgenic Mice Infected with Middle East Respiratory Syndrome-Coronavirus.
26644312 2016 Decreased Frequency and Secretion of CD26 Promotes Disease Progression in Indian Post Kala-azar Dermal Leishmaniasis.
26552750 2015 Chemotherapeutic agents attenuate CXCL12-mediated migration of colon cancer cells by selecting for CXCR4-negative cells and increasing peptidase CD26.
26474470 2015 Serum Levels of Soluble CD26/Dipeptidyl Peptidase-IV in Type 2 Diabetes Mellitus and Its Association with Metabolic Syndrome and Therapy with Antidiabetic Agents in Malaysian Subjects.
More...