Property Summary

NCBI Gene PubMed Count 49
PubMed Score 55.99
PubTator Score 36.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
urothelial carcinoma -1.900 7.3e-09
astrocytoma -1.200 1.8e-06
glioblastoma -2.700 2.0e-02
oligodendroglioma -1.300 5.4e-06
group 4 medulloblastoma -4.100 8.9e-08
atypical teratoid / rhabdoid tumor -3.000 3.0e-03
medulloblastoma, large-cell -3.600 5.2e-04
primitive neuroectodermal tumor -2.000 5.0e-02
intraductal papillary-mucinous adenoma (... -3.600 2.4e-04
intraductal papillary-mucinous carcinoma... -2.900 2.6e-02
intraductal papillary-mucinous neoplasm ... -4.100 2.0e-03
active Crohn's disease -3.756 4.4e-05
active ulcerative colitis -3.777 1.2e-04
pancreatic cancer -1.600 3.5e-03
interstitial cystitis -1.400 1.3e-02
adult high grade glioma -2.400 4.1e-04
lung carcinoma 1.500 1.2e-11
Pick disease -1.100 4.1e-02
ovarian cancer -3.900 1.2e-11
head and neck cancer and chronic obstruc... -1.300 6.6e-03
psoriasis -1.200 8.3e-13

Gene RIF (39)

PMID Text
26209633 The stoichiometry of the Kv4.2-DPP10 complex was variable depending on the relative expression level of each subunit, with a preference for 4:2 stoichiometry
25600224 the interaction of DPP10a, expressed in human atrium, with Kv4.3 channels generates a sustained current component of Ito, which may affect late repolarization phase of atrial action potentials.
25592153 study suggests a genetic contribution of DPP10 rs17048175 in eosinophilic inflammation induction in the airways and to aspirin-exacerbated respiratory disease susceptibility
25025038 Our results suggest that DPP10(789) is involved in the pathology of AD and other neurodegenerative diseases.
22387313 demonstrated that glycosylation was necessary for both DPP10 trafficking to the cell surface and functional interaction with Kv4 channels
22298003 Crystals of DPP10 obtained by the sitting-drop method were orthorhombic, belonging to space group P2(1)2(1)2(1) with unit-cell parameters a = 80.91, b = 143.73, c = 176.25 A.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20451256 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20414141 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20354865 N-linked glycosylation of DPP10 plays an important role in modulating Kv4.3 channel/KCHIP2 complex activities.
20200978 Observational study of gene-disease association. (HuGE Navigator)
20085599 We were unable to confirm associations of single nucleotide polymorphisms of the positional candidates DPP10 and PHF11 with wheeze. Significant associations with reported and examined eczema were only observed for DPP10.
20085599 Observational study of gene-disease association. (HuGE Navigator)
19996348 Observational study of gene-disease association. (HuGE Navigator)
19951440 Our study is the first one to provide additional evidence that supports the roles of DPP10 in influencing asthma or BHR in a Chinese population
19951440 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910030 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19910028 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19676137 REVIEW: role in health and disease
19672052 rs10208402 associated with percentage of peripheral blood eosinophils and log(e)-transformed total IgE in a Han Chinese population
19672052 Observational study of gene-disease association. (HuGE Navigator)
19308021 Observational study of gene-disease association. (HuGE Navigator)
19264973 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19237393 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17702965 Observational study of gene-disease association. (HuGE Navigator)
17702965 No consistent association was found between DPP10 and asthma susceptibility.
17475505 Data show that in the Kv4.2+KChIP3+DPP10 channel complex, all DPP10 variants accelerate channel gating kinetics; however, the splice variant DPP10a produces uniquely fast inactivation kinetics that accelerates with increasing depolarization.
16290253 although similar in structure and sequence to other dipeptidyl peptidases, it lacks vital residues required for dipeptidyl peptidase activity and has instead evolved features that enable it to act as a component of voltage-gated potassium channels
15911355 Interaction between transmembranes of DPP10/DPPX and Kv4 channel mediates functional complex formation. We call this protein DPPY, instead of DPP10, because of its revealed role as a Kv4 channel regulator.
12662155 cloning, characterization and mapping to chromosome 2

AA Sequence

MNQTASVSHHIKCQPSKTIKELGSNSPPQRNWKGIAIALLVILVVCSLITMSVILLTPDELTNSSETRLS      1 - 70
LEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIKLNIETNATTLLLENTTFVTFKASRHSVSPDLKYVL     71 - 140
LAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVLQYAAWGVQGQQLIYIFENNIYYQPDIKSSS    141 - 210
LRLTSSGKEEIIFNGIADWLYEEELLHSHIAHWWSPDGERLAFLMINDSLVPTMVIPRFTGALYPKGKQY    211 - 280
PYPKAGQVNPTIKLYVVNLYGPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVRWLNRAQNISILTVCE    281 - 350
TTTGACSKKYEMTSDTWLSQQNEEPVFSRDGSKFFMTVPVKQGGRGEFHHVAMFLIQSKSEQITVRHLTS    351 - 420
GNWEVIKILAYDETTQKIYFLSTESSPRGRQLYSASTEGLLNRQCISCNFMKEQCTYFDASFSPMNQHFL    421 - 490
LFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKKIGKPEIKILHIDDYELPLQLSLPKDFMDRNQ    491 - 560
YALLLIMDEEPGGQLVTDKFHIDWDSVLIDMDNVIVARFDGRGSGFQGLKILQEIHRRLGSVEVKDQITA    561 - 630
VKFLLKLPYIDSKRLSIFGKGYGGYIASMILKSDEKLFKCGSVVAPITDLKLYASAFSERYLGMPSKEES    631 - 700
TYQAASVLHNVHGLKEENILIIHGTADTKVHFQHSAELIKHLIKAGVNYTMQVYPDEGHNVSEKSKYHLY    701 - 770
STILKFFSDCLKEEISVLPQEPEEDE                                                771 - 796
//

Text Mined References (51)

PMID Year Title
26209633 2015 Kv4.2 and accessory dipeptidyl peptidase-like protein 10 (DPP10) subunit preferentially form a 4:2 (Kv4.2:DPP10) channel complex.
25600224 2015 Interaction of DPP10a with Kv4.3 channel complex results in a sustained current component of human transient outward current Ito.
25592153 2015 Dipeptidyl-peptidase 10 as a genetic biomarker for the aspirin-exacerbated respiratory disease phenotype.
25025038 2014 Dipeptidyl peptidase 10 (DPP10(789)): a voltage gated potassium channel associated protein is abnormally expressed in Alzheimer's and other neurodegenerative diseases.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22387313 2012 N-glycosylation of the mammalian dipeptidyl aminopeptidase-like protein 10 (DPP10) regulates trafficking and interaction with Kv4 channels.
22298003 2012 Crystallization and preliminary X-ray diffraction analysis of human dipeptidyl peptidase 10 (DPPY), a component of voltage-gated potassium channels.
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20701904 2010 Early life environment, neurodevelopment and the interrelation with atopy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20451256 2010 A genome-wide association study of bipolar disorder in Norwegian individuals, followed by replication in Icelandic sample.
20414141 2010 Family-based association study for bipolar affective disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20354865 2010 Impaired glycosylation blocks DPP10 cell surface expression and alters the electrophysiology of Ito channel complex.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
19996348 2010 Positionally cloned genes and age-specific effects in asthma and atopy: an international population-based cohort study (ECRHS).
19951440 2009 Analyses of associations between three positionally cloned asthma candidate genes and asthma or asthma-related phenotypes in a Chinese population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910030 2010 Evaluation of candidate genes in a genome-wide association study of childhood asthma in Mexicans.
19910028 2010 A genome-wide association study on African-ancestry populations for asthma.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19676137 2009 Dipeptidyl peptidase (DP) 6 and DP10: novel brain proteins implicated in human health and disease.
19672052 2010 Polymorphisms of PHF11 and DPP10 are associated with asthma and related traits in a Chinese population.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19237393 2009 Positionally cloned asthma susceptibility gene polymorphisms and disease risk in the British 1958 Birth Cohort.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17702965 2007 Comprehensive testing of positionally cloned asthma genes in two populations.
17475505 2007 DPP10 splice variants are localized in distinct neuronal populations and act to differentially regulate the inactivation properties of Kv4-based ion channels.
16899223 2006 Species and tissue differences in the expression of DPPY splicing variants.
16290253 2006 Molecular characterization of a novel dipeptidyl peptidase like 2-short form (DPL2-s) that is highly expressed in the brain and lacks dipeptidyl peptidase activity.
15911355 2005 Transmembrane interaction mediates complex formation between peptidase homologues and Kv4 channels.
15829243 2005 Recent findings on genes associated with inflammatory disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15671030 2005 DPP10 modulates Kv4-mediated A-type potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454437 2004 Modulation of Kv4.2 channel expression and gating by dipeptidyl peptidase 10 (DPP10).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14566338 2003 Positional cloning of a novel gene influencing asthma from chromosome 2q14.
12675227 2003 Dipeptidyl peptidase IV gene family. The DPIV family.
12662155 2003 Cloning and characterization of dipeptidyl peptidase 10, a new member of an emerging subgroup of serine proteases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.