Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.50
PubTator Score 12.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 4.9e-02
ovarian cancer 1.600 2.0e-03
psoriasis 2.000 2.2e-05

Protein-protein Interaction (1)

AA Sequence

MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDA      1 - 70
ARELQSQIQEARADLARRGLRF                                                     71 - 92
//

Text Mined References (14)

PMID Year Title