Property Summary

NCBI Gene PubMed Count 12
PubMed Score 18.10
PubTator Score 6.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia 2.100 4.4e-02
atypical teratoid / rhabdoid tumor 1.400 9.9e-04
Breast cancer 1.100 2.7e-05
ependymoma 1.200 1.5e-07
glioblastoma 1.500 5.0e-07
intraductal papillary-mucinous neoplasm ... 1.200 2.4e-02
non-small cell lung cancer -1.353 1.6e-19
ovarian cancer -1.900 3.3e-06
pancreatic ductal adenocarcinoma liver m... -1.299 3.2e-02
pediatric high grade glioma 1.700 4.6e-07
primitive neuroectodermal tumor 1.300 2.8e-04
psoriasis 1.100 1.2e-34

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETV      1 - 70
PAPSANKELVKC                                                               71 - 82
//

Text Mined References (12)

PMID Year Title