Property Summary

NCBI Gene PubMed Count 3
PubMed Score 8.54
PubTator Score 6.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 2514 5.6e-11
osteosarcoma 7933 1.1e-03
group 3 medulloblastoma 2254 2.5e-03
Disease Target Count Z-score Confidence
spina bifida 1064 3.061 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.198 1.1e-03
ependymoma -1.100 5.6e-11
group 3 medulloblastoma -1.500 2.5e-03

AA Sequence

MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDS      1 - 70
QTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPE     71 - 140
GPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQ    141 - 210
DTASLEDRDKPYVCDKFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCG    211 - 280
RSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSP    281 - 350
PMAEPPEGSWSCHLCLRHLKEKASAYITLT                                            351 - 380
//

Text Mined References (6)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8812431 1996 The d4 gene family in the human genome.