Property Summary

NCBI Gene PubMed Count 35
PubMed Score 552.35
PubTator Score 64.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.482 5.3e-04
osteosarcoma -2.198 2.9e-06
tuberculosis 1.600 3.8e-06
lung cancer 1.800 3.8e-04
non primary Sjogren syndrome sicca 1.100 2.3e-02
ovarian cancer 1.400 3.6e-05

Protein-protein Interaction (10)

Gene RIF (14)

PMID Text
25408354 Data suggest that N-acetylglucosaminyl 1-phosphate transferase is a breast cancer therapeutic target.
23703614 Data suggest that in oral squamous cell carcinoma (OSCC), dysregulation of canonical Wnt signaling and DPAGT1-dependent N-glycosylation induces CTHRC1, thereby driving OSCC cell migration and tumor spread.
23591138 prominent limb-girdle weakness and minimal craniobulbar symptoms who harbour a novel mutation in DPAGT1
23447650 Patients with DPAGT1 CMS share similar clinical features with patients who have CMS caused by mutations in GFPT1, another recently identified CMS subtype.
23278575 suggest that the primary pathogenic mechanism of DPAGT1-associated CMS is reduced levels of AChRs at the endplate region. This finding demonstrates that impairment of the N-linked glycosylation pathway can lead to the development of CMS
23249953 Results indicate that the clinical spectrum of dolichyl-phosphate alpha-N-acetylglucosaminyltransferase (DPAGT1)-congenital disorders of glycosylation (CDG) is much broader than appreciated so far.
23178939 Studies show that cells coordinate DPAGT1 expression and protein N-glycosylation with canonical Wnt signaling and E-cadherin adhesion via positive and negative feedback mechanisms.
22742743 We identify DPAGT1 as a gene in which mutations cause a congenital myasthenic syndrome.
22341307 Overexpression of DPAGT1 in human oral squamous cell carcinoma specimens is linked to aberrant activation of canonical Wnt signaling.
22304930 Mutations in DPAGT1 gene is associated with Congenital disorder of glycosylation type Ij.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20693288 up-regulation of DPAGT1 transcripts by Wnt3a led to altered N-glycosylation of E-cadherin.
19549906 Studies show for the first time that DPAGT1 is an upstream regulator of E-cadherin N-glycosylation status and adherens junction composition and suggest that dysregulation of DPAGT1 causes disturbances in intercellular adhesion in oral cancer.
19519349 REVIEW: Structure, expression, and regulation

AA Sequence

MWAFSELPMPLLINLIVSLLGFVATVTLIPAFRGHFIAARLCGQDLNKTSRQQIPESQGVISGAVFLIIL      1 - 70
FCFIPFPFLNCFVKEQCKAFPHHEFVALIGALLAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLMVY     71 - 140
FTNFGNTTIVVPKPFRPILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNL    141 - 210
VELEGDCRDDHVFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFM    211 - 280
PQVFNFLYSLPQLLHIIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSET    281 - 350
EDGEFTECNNMTLINLLLKVLGPIHERNLTLLLLLLQILGSAITFSIRYQLVRLFYDV                351 - 408
//

Text Mined References (34)

PMID Year Title
25408354 2015 N-acetylglucosaminyl 1-phosphate transferase: an excellent target for developing new generation breast cancer therapeutic.
23703614 2013 N-glycosylation induces the CTHRC1 protein and drives oral cancer cell migration.
23591138 2013 Clinical features in a large Iranian family with a limb-girdle congenital myasthenic syndrome due to a mutation in DPAGT1.
23447650 2013 Clinical features of congenital myasthenic syndrome due to mutations in DPAGT1.
23278575 2012 Identification of DPAGT1 as a new gene in which mutations cause a congenital myasthenic syndrome.
23249953 2013 A compound heterozygous mutation in DPAGT1 results in a congenital disorder of glycosylation with a relatively mild phenotype.
23178939 2013 Coordinate regulation of N-glycosylation gene DPAGT1, canonical Wnt signaling and E-cadherin adhesion.
22742743 2012 Mutations in DPAGT1 cause a limb-girdle congenital myasthenic syndrome with tubular aggregates.
22341307 2012 Aberrant amplification of the crosstalk between canonical Wnt signaling and N-glycosylation gene DPAGT1 promotes oral cancer.
22304930 2012 Congenital disorder of glycosylation type Ij (CDG-Ij, DPAGT1-CDG): extending the clinical and molecular spectrum of a rare disease.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20693288 2010 N-glycosylation gene DPAGT1 is a target of the Wnt/beta-catenin signaling pathway.
19549906 2009 Overexpression of DPAGT1 leads to aberrant N-glycosylation of E-cadherin and cellular discohesion in oral cancer.
19519349 2009 Structure, expression, and regulation of UDP-GlcNAc: dolichol phosphate GlcNAc-1-phosphate transferase (DPAGT1).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12872255 2003 Deficiency of UDP-GlcNAc:Dolichol Phosphate N-Acetylglucosamine-1 Phosphate Transferase (DPAGT1) causes a novel congenital disorder of Glycosylation Type Ij.
12855228 2003 Congenital disorder of glycosylation Ic in patients of Indian origin.
12618564 2003 New disorders in carbohydrate metabolism: congenital disorders of glycosylation and their impact on the endocrine system.
12592703 2002 Genomic structure of the human UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417423 2002 Human disorders in N-glycosylation and animal models.
11805072 2001 Update and perspectives on congenital disorders of glycosylation.
10024536 1999 Regulation of UDP-N-acetylglucosamine:dolichyl-phosphate N-acetylglucosamine-1-phosphate transferase by retinoic acid in P19 cells.
9451016 1998 Cloning and functional expression of the human GlcNAc-1-P transferase, the enzyme for the committed step of the dolichol cycle, by heterologous complementation in Saccharomyces cerevisiae.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8244387 1993 A sequence-tagged site map of human chromosome 11.
8179616 1994 Major defect of carbohydrate-deficient-glycoprotein syndrome is not found in the synthesis of dolichyl phosphate or N-acetylglucosaminyl-pyrophosphoryl-dolichol.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6289658 1982 Demonstration of the heterozygous state for I-cell disease and pseudo-Hurler polydystrophy by assay of N-acetylglucosaminylphosphotransferase in white blood cells and fibroblasts.
3038274 1987 Dolichol-linked glycoprotein synthesis in developing mammalian brain: maturational changes of the N-acetylglucosaminylphosphotransferase.